(data stored in ACNUC16935 zone)

EMBL: BN001307.PE272

BN001307.PE272       Location/Qualifiers
FT   CDS_pept        join(752372..752488,752566..752810,752869..753025)
FT                   /locus_tag="ANIA_01444"
FT                   /old_locus_tag="AN1444.4"
FT                   /product="NADH-ubiquinone oxidoreductase 178 kDa subunit,
FT                   putative (AFU_orthologue; AFUA_8G04320)"
FT                   /note="transcript_id=CADANIAT00008057"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008057"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008057"
FT                   /db_xref="GOA:Q5BDD6"
FT                   /db_xref="InterPro:IPR034444"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDD6"
FT                   /protein_id="CBF84870.1"
FT                   /translation="MILARRSVASARLLLRNQQPRRFDSHAAHHAEPVNESFGRSFYVA
FT                   VGTFASCFALYQFTKPGKVADSQSALTRLIEKWTPSEKVFEERNALHTAAAERAARDRH
FT                   LFLSQAPSEVYELKSPESSFHPGHPYNVIAGSKADLSEVIAHYERKNQKIEEARVARMQ
FT                   DGKVVSIYD"
     atgattcttg cccggcgttc ggtagcttcg gcgcggcttc tgctgcgaaa ccagcaacct        60
     cgacgatttg actcacacgc agctcaccat gccgagcctg tgaacgaaag cttcggccgt       120
     agcttctacg tcgccgtcgg taccttcgct tcctgcttcg cgctttacca gttcacgaag       180
     cctgggaagg tcgccgactc gcaatcagcc ctcacccgcc tcatcgagaa gtggactccc       240
     tcggagaagg tctttgagga gagaaacgcg cttcacacag ctgccgctga gagggctgcc       300
     cgggaccgcc acctcttcct cagtcaggca cccagtgagg tgtatgaatt gaagagcccg       360
     gaatcgagct tccaccctgg ccacccgtac aatgtcatcg ctggcagcaa ggctgacttg       420
     agtgaggtca ttgcccacta cgagcgtaag aaccagaaga tcgaagaggc ccgcgttgct       480
     cgtatgcagg atggcaaggt tgtttctatt tatgactag                              519
//

If you have problems or comments...

PBIL Back to PBIL home page