(data stored in ACNUC16935 zone)

EMBL: BN001307.PE273

BN001307.PE273       Location/Qualifiers
FT   CDS_pept        complement(join(753251..753931,754022..754363,
FT                   754464..754625))
FT                   /locus_tag="ANIA_01445"
FT                   /old_locus_tag="AN1445.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008058"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008058"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008058"
FT                   /db_xref="GOA:Q5BDD5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDD5"
FT                   /protein_id="CBF84871.1"
FT                   /translation="MASKFSFGFSGDDIDIDLDENELDDATESGHQDAGTASTLPELVK
FT                   AQKHEIDEWLSMLPSQISYNTCTISPFQEKGLGQGASASTDIGANTVTVARRDVFDIRA
FT                   QLMVEDSAEEQNGELIAGLEKGDITPNFYEGGFKTWECSIDLAGLVVGEGVGLEDEGED
FT                   RHVIELGSGTAVPSLAVFAQLLARTETDGTTSKPAEKKKQTHFTFADYNSAVLRLVTVP
FT                   NLLLTWNHFTTHRKSAQPSDGQSEDKAESQEEMLDITPDLVERFQSDLAHRGITVSFIS
FT                   GAWSPSFVELVFSSPELAGYRTLILASETIYSPASLAAFSETLLMLLRRSSQSNHASRA
FT                   LVAAKKVYFGVGGGVDEFLTILRSVADGNVDVGERMDVKSAGVGRTILEVSAST"
     atggcctcca aattcagttt tggcttctct ggcgacgata tcgatatcga tcttgacgag        60
     aatgagcttg atgatgccac agagagtggc caccaggatg ctggcacagc atctacgctc       120
     ccagagcttg tgaaagctca aaaacatgaa attgatgagt ggctctccat gctcccatca       180
     cagatatcgt acaatacgtg cactatctct ccctttcagg agaagggcct ggggcaaggt       240
     gcaagcgcaa gtacagatat aggagcaaat actgttactg tcgcacgcag ggacgtcttc       300
     gatattcgcg cccagctaat ggtggaggat agtgctgagg agcagaacgg cgagttgatc       360
     gccggacttg agaagggtga catcacgcct aatttctacg agggcgggtt taagacgtgg       420
     gagtgctcta ttgatttggc tgggctggtt gttggcgagg gagtgggact ggaggatgag       480
     ggtgaggata gacatgttat tgagcttggt tcagggaccg cggttccctc gctggcggta       540
     tttgctcagt tgctcgctcg gacggagaca gacgggacaa catcaaagcc agcagagaag       600
     aaaaaacaaa ctcactttac atttgcagac tataactccg ctgttctacg tctggtgact       660
     gtaccgaatc tacttttaac atggaatcac tttaccacgc accgcaagtc ggctcaaccg       720
     tccgatggcc agtcagagga caaagcagag agtcaagaag agatgctaga cataacaccc       780
     gaccttgttg aacgctttca atctgacctc gcgcacagag gaattactgt ctctttcatc       840
     tcaggcgcct ggtcaccgtc attcgtggag ctggtgtttt cgtcaccgga actggcgggt       900
     tataggacgc ttattcttgc aagtgagacg atttactcgc ctgcttcatt agccgctttc       960
     tcggaaacgt tgttgatgtt gctgcgccgt tcttcgcaga gtaatcatgc gagtagggcg      1020
     cttgtggccg cgaagaaggt ctactttggt gttggagggg gcgtcgatga gtttctgact      1080
     attttgagga gtgtagctga tgggaatgtt gatgttggag agcggatgga cgtcaaatct      1140
     gctggagtgg gaaggacaat cctggaggtt agcgcgagta cttag                      1185
//

If you have problems or comments...

PBIL Back to PBIL home page