(data stored in ACNUC16935 zone)

EMBL: BN001307.PE275

BN001307.PE275       Location/Qualifiers
FT   CDS_pept        complement(join(757013..757064,757194..757234,
FT                   757459..757633,757680..757743,757796..757882,
FT                   757947..758043,758117..758215,758271..758282))
FT                   /locus_tag="ANIA_01447"
FT                   /old_locus_tag="AN1447.4"
FT                   /product="DNA-directed RNA polymerase III subunit 22.9 kDa,
FT                   putative (AFU_orthologue; AFUA_8G04350)"
FT                   /note="transcript_id=CADANIAT00008060"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008060"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008060"
FT                   /db_xref="GOA:Q5BDD3"
FT                   /db_xref="InterPro:IPR005576"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013238"
FT                   /db_xref="InterPro:IPR036898"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDD3"
FT                   /protein_id="CBF84875.1"
FT                   /translation="MFILTTISDLIQISPEDFSKYSSVAIEDNINEKYANKVIQKIGLC
FT                   IGFYDLLESSDGLIGHGTGLVNVNVKFRLIVFRPFRGEIVLGKISSATENGIKIGVEFF
FT                   NDILVPPDLLLDGARFDYQDQVWIWENEEGTFYFDVGEVVRFRVEMEEWHDQIPNAPDL
FT                   GDGAPIDRKPPYSIIRGRTLSSPSGSYIRAILMYGLGYRRNEIGQ"
     atgtttatcc ttaccaccat ctcagatctt attcagattt ccccagagga tttttcaaaa        60
     tatagttccg ttgccatcga ggacaacatt aatgaaaagt acgccaacaa agtcattcag       120
     aagattgggc tctgtattgg tttctatgat ctcttagagt catcagatgg tctgatcggc       180
     catggcactg ggctcgtcaa tgtgaacgtg aagttccggc ttattgtgtt tcgcccattt       240
     aggggggaga ttgtgctggg caagatctca agcgctactg aaaatggcat aaaaatcggc       300
     gtagaatttt tcaacgacat cttggtacct ccagacctcc ttctggatgg cgctagattt       360
     gattaccagg accaggtttg gatctgggaa aacgaagaag ggacgttcta cttcgatgta       420
     ggagaagttg tccgcttccg cgttgaaatg gaagaatggc atgaccagat tcccaatgct       480
     cctgatcttg gagatggcgc tccaattgac cgcaagcctc cgtattctat tattcgaggt       540
     agaacactca gctctccctc gggttcctac atacgtgcga ttttgatgta tggcctcggt       600
     tatcgccgga acgagattgg acagtag                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page