(data stored in ACNUC16935 zone)

EMBL: BN001307.PE276

BN001307.PE276       Location/Qualifiers
FT   CDS_pept        join(758721..760439,760507..760749)
FT                   /locus_tag="ANIA_01448"
FT                   /old_locus_tag="AN1448.4"
FT                   /product="CCCH zinc finger protein (AFU_orthologue;
FT                   AFUA_8G04360)"
FT                   /note="transcript_id=CADANIAT00008061"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008061"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008061"
FT                   /db_xref="GOA:Q5BDD2"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR019496"
FT                   /db_xref="InterPro:IPR036855"
FT                   /db_xref="InterPro:IPR039136"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDD2"
FT                   /protein_id="CBF84877.1"
FT                   /translation="MNPQGFSFPPPPPPPPTQHPPQQQYAHNNAFTPYGQNHHGQRGGR
FT                   GGGQFRGRGRGYGNRGRGGHFMSSDANHSGGYAAAHAGYAPMTHSGYPAQHMPNQQTGI
FT                   PTPHYTQSSSQAFSNAVTGSTFASTSHYPQPAVNGTAYQHQSSYGTTYATPTQQSPPYT
FT                   QTHPAHQNATPSVQPTMMGPPIRWGFEGTGHSGSFPGLQRPSQRGPRQNNTYNNQSSPG
FT                   KHANKRDHTSAFGKPQSTAPRFPAPPPVPSFGNPLPLKPPTPVDSQRKPKKKKRKHNQL
FT                   GLTPKTEEHESSEEEDDADEETRLASGGPGTGVALQITYKGRTSNLQTSADIAAWIAER
FT                   KKRFPTQAKIEEKKKAMEEAKKAKKAREEAQRQQREARKSAATRAKDQEKKEQTRVALD
FT                   PADAAAKAKMKAEKLRRKLLKEEKRIAQAEADAERARKMDGVQEDSVPTEREADQPEKK
FT                   DSAANEQAVGDLASDASDDSDWTSSSGSDLSSSDSDESSDDDDDDSAPEQATSRREGPE
FT                   RVAPPARDEKKRICRHFARNGRCPRGKTCKFAHEKPDRGTKAQPVENKGRKGLLEALLD
FT                   RQKEDENRKLMETIIWLGENGLLDEPAAQQDVFSTDPTRQTDESTGPLDASDIQLGNVS
FT                   TSGSVGEQCHPSEGTARV"
     atgaaccctc agggattctc cttccctccc cctccacctc cgcctcctac acaacatccg        60
     ccgcaacaac aatacgctca taacaatgcg ttcacgccgt atgggcagaa tcaccatggt       120
     caacggggtg gccgcggggg tggccaattc aggggccgtg ggagaggcta cgggaataga       180
     ggtagaggag gtcatttcat gagctccgat gccaatcact ctggcggcta cgcggcagct       240
     catgctggat atgcgcccat gacacactca gggtacccag ctcaacatat gccaaatcaa       300
     caaacaggca ttccgacgcc gcattatacg cagtcgtctt cgcaggcttt ttcgaatgcc       360
     gtgactggga gtacattcgc ctctacgtcg cattatccgc aacctgccgt taatggcacg       420
     gcttatcagc atcaatcaag ctatggtact acatatgcaa cacctacaca acaatcccct       480
     ccatacactc aaacacatcc tgctcatcaa aatgctacgc catcggtgca gccgacaatg       540
     atgggccctc ctatccgctg gggtttcgag ggcacaggac attcaggctc atttccagga       600
     ttgcagcgtc ccagccaacg gggaccgcgt cagaacaaca cctataataa tcagagctct       660
     cccggcaaac atgcgaacaa gcgcgaccac acgtcagcat ttggcaagcc tcagtcgaca       720
     gctccacgat tcccggcgcc acctccggtc cctagtttcg gtaatcctct gcctttgaaa       780
     ccgcctacgc cggttgattc gcaacggaaa cccaagaaga agaagcggaa gcataaccag       840
     ctagggttaa ccccgaagac tgaggagcac gagtccagtg aggaggaaga tgacgccgat       900
     gaggaaacca ggttggcatc cggtggccca ggcactgggg tagcattgca aatcacgtac       960
     aaaggacgaa catcaaatct gcagacatct gcagatatcg cagcttggat cgcagagcgc      1020
     aagaagcgtt tccctaccca agcgaaaatt gaagagaaaa agaaagctat ggaggaagca      1080
     aagaaggcga agaaagccag agaagaagct caacggcagc agagggaagc tcgcaagtca      1140
     gcggctaccc gtgcaaagga ccaagaaaag aaagagcaga ctcgagtcgc cctggatccc      1200
     gccgatgcag ccgcgaaagc caaaatgaag gccgagaagt tacgacggaa gctattgaag      1260
     gaggagaaac ggatagcgca ggcagaggct gatgctgagc gcgctcgcaa aatggacggg      1320
     gtccaagaag attcagtgcc gactgaacga gaagccgatc aacctgaaaa gaaagattcc      1380
     gcagctaacg aacaagccgt tggcgatttg gcgtccgacg cgtctgacga tagcgactgg      1440
     acttcctcaa gcgggtctga tctgtcatcc tctgattctg atgaaagtag cgatgacgat      1500
     gacgacgatt ctgcgccgga gcaagcaaca tcacgtcggg agggacccga acgggtcgcg      1560
     ccgccggcgc gcgacgagaa gaagcgtatc tgtcggcatt ttgcccgcaa cggccgttgt      1620
     cctcgaggca agacctgcaa gtttgctcac gagaagcctg accgtgggac caaagcacaa      1680
     ccagtcgaga acaagggacg aaaaggactc cttgaagcgc tcctcgaccg ccagaaagaa      1740
     gacgagaacc ggaaactgat ggagacgatt atatggctag gagagaacgg gctgctcgac      1800
     gaaccggcgg ctcaacaaga cgttttttca actgatccga cccgtcagac tgatgagtcc      1860
     acggggccgc tcgatgcgag cgacatccag ttgggcaacg tctccacctc tggctctgtg      1920
     ggcgagcaat gccatccttc ggaaggaacg gcgcgtgtat ga                         1962
//

If you have problems or comments...

PBIL Back to PBIL home page