(data stored in ACNUC16935 zone)

EMBL: BN001307.PE277

BN001307.PE277       Location/Qualifiers
FT   CDS_pept        join(762660..762867,762926..763416)
FT                   /locus_tag="ANIA_01449"
FT                   /old_locus_tag="AN1449.4"
FT                   /product="GPI anchored protein, putative (AFU_orthologue;
FT                   AFUA_8G04370)"
FT                   /note="transcript_id=CADANIAT00008062"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008062"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008062"
FT                   /db_xref="GOA:Q5BDD1"
FT                   /db_xref="InterPro:IPR018466"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDD1"
FT                   /protein_id="CBF84879.1"
FT                   /translation="MRSVFFFALSAVATLVAARENAFNIPKNGYSFTAGEATTLSWEPS
FT                   TEGTVTLKLQHGEVLTSDSGTTIASSIPNSGSFTWSVPSDIEDYSDYTIEIISDSDPDA
FT                   TNYLPRFSVEGAEEVTTTSSTTSTETTTTTTTTETSSTTTETTLTTTTTTTTESTTSPT
FT                   PTSTTETPSKTPASATSTESSSTSTSSESATDTPTSVPNVNGEDGDNAGMSNRVSGGLL
FT                   VLALGVAALV"
     atgcgttccg tattcttctt cgcactcagc gctgtcgcta ctctggtcgc cgcgcgcgaa        60
     aacgccttca acatccccaa aaatggatat tcattcactg ctggcgaggc caccaccctg       120
     agctgggaac ccagcactga aggaaccgtg actctcaaac ttcagcacgg cgaggtcttg       180
     acttccgatt ctggcaccac cattgcttct tccattccta actccggaag cttcacctgg       240
     agcgtgcctt ctgatatcga ggattactct gactacacca tcgaaatcat cagtgactct       300
     gacccggacg ccaccaacta tctcccccgt ttctctgttg agggcgccga ggaagtgacc       360
     actacttcgt ctacgaccag cactgagacg acgacgacca ccaccaccac ggagacctct       420
     agcactacca cagagaccac cctgaccacc accactacta ccactactga gtcgactacc       480
     tccccgactc cgacttccac caccgagacc cctagcaaga cccccgccag cgctacctct       540
     actgagtctt ccagcaccag cacctcgtcg gagtctgcca ctgacacccc tacctcggtt       600
     cctaacgtga acggtgagga tggtgacaac gcgggcatgt ccaaccgcgt ttccggtggc       660
     ctgttggtgc ttgcgcttgg tgttgctgct ctcgtctaa                              699
//

If you have problems or comments...

PBIL Back to PBIL home page