(data stored in ACNUC16935 zone)

EMBL: BN001307.PE278

BN001307.PE278       Location/Qualifiers
FT   CDS_pept        complement(join(764818..765612,765698..765835))
FT                   /locus_tag="ANIA_01450"
FT                   /old_locus_tag="AN1450.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008063"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008063"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008063"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDD0"
FT                   /protein_id="CBF84880.1"
FT                   /translation="MAKLDQDKTCHLHHAADVTRALIEGLVKMDQVHACRGQVTAANLD
FT                   QTRSWTVRIQDTDSLNEMEVMTPRLILCTGSSPTKTPIPVDAHGIQRLDLDVVLKPSEL
FT                   ASALPQNQPTTVAVVGASHSAVLALLNLYDLARTSHSHLRIKWFTRHPLRYAEYMDGWI
FT                   LRDNTGLKGRAADFARQQLEDSVLPTSEAGRYITKIDCAGGQSKETAQYQRHLPSCTHI
FT                   TQAIGYTRDPLPELSINRSPLSPDDLQWDSSFGGFTDRHGRVIPGLHGAGIAFPERVVD
FT                   PYGNVEHAVGFFKFMKFLKRVTPQWAATA"
     atggcgaagc tcgatcagga caaaacctgt catctccacc atgcggcaga tgttactaga        60
     gctttgattg aaggcctcgt aaagatggac caggtgcatg cctgccgcgg ccaagttacc       120
     gcagccaatc tagatcaaac acgttcatgg acagtacgga ttcaagatac ggactctctg       180
     aatgaaatgg aagtcatgac gccccgattg attctctgca ccgggtcgtc tccgacaaaa       240
     actcctattc cagttgatgc acacggcatt cagagactcg acctagacgt agtgctgaaa       300
     ccaagcgagc tagcttcagc ccttcctcag aaccagccaa cgaccgtcgc agtagtgggc       360
     gcatctcaca gcgccgtcct agccctactc aatctctacg acttggctcg tacttctcac       420
     tcacatctcc gcatcaagtg gttcacccgc catcctcttc ggtatgccga gtacatggac       480
     ggctggatcc ttcgcgacaa cacaggtctc aagggccgtg ctgccgactt tgcccgccaa       540
     cagctagaag acagtgtgct gccgacatca gaagcaggcc gatacatcac caagattgac       600
     tgcgccggtg gccagagtaa ggaaacagcg caatatcaac gccatctccc ttcctgcaca       660
     cacatcaccc aggctatcgg gtacacccgt gatccgcttc cggagctttc gatcaacaga       720
     tccccacttt ctccagatga cctccagtgg gattcgagct tcggtggctt cacggaccgc       780
     cacggccgag ttatccccgg cctgcatggt gcgggcatcg cgttccctga gcgtgtcgtc       840
     gacccttacg gtaatgtaga gcatgctgtg gggttcttca agttcatgaa attccttaaa       900
     cgtgttactc cgcagtgggc tgctacggca taa                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page