(data stored in ACNUC16935 zone)

EMBL: BN001307.PE279

BN001307.PE279       Location/Qualifiers
FT   CDS_pept        complement(join(767258..767809,767884..768204))
FT                   /locus_tag="ANIA_01451"
FT                   /old_locus_tag="AN1451.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008064"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008064"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008064"
FT                   /db_xref="GOA:Q5BDC9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDC9"
FT                   /protein_id="CBF84882.1"
FT                   /translation="MFVRLPFRGRHPMRPAPSRSNEPPEGETEYQQLENQFYPSISDAL
FT                   RVRHLLLWKVQPEGLPAEVVDMIVDAAEYWPSTKVKLDKARRIEKDVDQAVLCTSPLCY
FT                   DEKSLDTPQPKLLPHRTVHPCRKIVFSILSHDQGGYTERHLAGPNNQSPYEHTCTWFDA
FT                   EVIHQAHKPSQKSAINGKMNPTDMRPQHFGPNDPLLLPRNNALQRNRTRIYEAKRHNII
FT                   WHYLDDVAADSQEAEDIARETGRGRDTVGGKQVREMEIGDSIMIWARARFPGWRNYVDD
FT                   VSVQVFWAV"
     atgtttgttc gccttccatt taggggtcga catcctatgc ggcctgcgcc gagcaggagc        60
     aacgaaccac cagagggaga gacagaatat caacaactag agaatcagtt ttatcctagc       120
     atctctgatg ctctcagggt ccggcacctt ctgctctgga aggtacagcc agaagggctt       180
     ccagcggagg tggtggacat gattgtggac gccgctgaat actggccgtc aacgaaggtc       240
     aagttggata aagctagaag gatcgaaaaa gatgtggacc aagcggtgct ttgtacgagc       300
     cctctttgct atgatgagaa gagtctggac acaccccaac ctaagctcct tccgcacagg       360
     actgttcacc catgccgaaa gatagtcttc tcaattctct ctcatgatca aggtggttat       420
     actgaacgtc atttggctgg tccaaataac caatctccct atgagcacac ctgcacctgg       480
     tttgacgccg aggtaatcca tcaagcgcat aagccatcac agaagagtgc cataaatgga       540
     aagatgaacc ccacagatat gaggccacag cattttggcc ccaatgaccc tctgctgctt       600
     ccaaggaata atgcactaca gcgcaaccgc actcgaatat atgaagcaaa acggcataat       660
     attatctggc actacctaga tgacgttgcg gctgactctc aagaggcaga ggatatcgca       720
     cgtgagacag gcagaggacg ggacactgtg ggcgggaagc aggttcggga gatggaaatc       780
     ggggactcta taatgatatg ggcacgagca cgatttccag gatggcgaaa ttatgtggat       840
     gatgtctcgg tgcaggtgtt ttgggctgta tag                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page