(data stored in ACNUC16935 zone)

EMBL: BN001307.PE280

BN001307.PE280       Location/Qualifiers
FT   CDS_pept        complement(join(768719..770161,770234..770353))
FT                   /locus_tag="ANIA_01452"
FT                   /old_locus_tag="AN1452.4"
FT                   /product="Nucleolar protein 12
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5BDC8]"
FT                   /note="transcript_id=CADANIAT00008065"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008065"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008065"
FT                   /db_xref="GOA:Q5BDC8"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034777"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5BDC8"
FT                   /protein_id="CBF84884.1"
FT                   /translation="MGKKSKSQKEAPATESAGSLPFLGGNVSVDPSLASLFEQSAGPVK
FT                   VPEVPRLGAAPKTKITDVEKDEEESSSAGNDSASEDQFMEDAPESPDAAEEAVQAVPEP
FT                   PSRKRKRAAGEDLEESYMRRLAKEEQKEQKKRRAERSSSLEEESEDGEKESPQSEDGES
FT                   EDEGADIPKHEALAGAANDDDELSKSNRTVFLGNVSTKAITSKSAKKELMKHLSSFLST
FT                   LPESTGPHKIDSIRFRSTAFASGGKIPKRAAFAKQEIHDDTTPSTNAYAVYSTAQAAKK
FT                   APAALNGTVVLDRHLRVDNVAHPAKVDHKRCVFVGNLDFIDNETGTEEGEKKKKNRPPA
FT                   DVEEGLWRTFNAHTKASQSGPAGRGNVESVRVVRDRSTRVGKGFAYVQFYDQNCVEEAL
FT                   LLNDKRFPPLLPRKLRVVRAKKVAKKSVETTGAPKGSDRTLQGRAGKLLGRSSEARLKA
FT                   AAKKSISQSSLVFEGNRATADGSSRIRVRTKSRGSKAKKDSRSKKRAAAYKAAGGKKAK
FT                   IGK"
     atgggcaaga agtctaagtc acaaaaggag gcgcctgcga cagagagcgc aggctcgctg        60
     cctttcttgg gcggaaatgt ctccgtggat ccttcattgg cttcactgtt tgaacaaagt       120
     gccggaccag taaaggttcc agaagtacct cgtctgggcg ctgctccgaa gacgaagata       180
     actgatgttg agaaggatga ggaggaatca tcaagcgcgg gaaatgattc tgcctccgaa       240
     gatcagttca tggaggatgc gccggagtcg cctgatgctg ctgaagaggc cgtccaagct       300
     gtcccggagc cgccaagtcg gaaacgaaag cgagctgctg gggaagatct tgaagagtcg       360
     tacatgcgtc gactagcaaa ggaggagcag aaggaacaga agaagcgtcg agcagaacgg       420
     tcaagctcac tggaagagga gagcgaggac ggtgaaaaag agagcccaca atccgaagac       480
     ggcgagtcgg aggatgaagg tgcggatatt cccaaacacg aagctctagc tggtgctgcc       540
     aacgatgatg atgagctctc caagtcgaat cgaaccgtat ttttgggcaa cgtgtctaca       600
     aaggcaatca cgtcgaagtc ggctaagaaa gagttgatga agcatctttc gtcattcctc       660
     tcgacacttc ctgagtctac gggtccccac aagatagatt cgatacgttt ccggtctact       720
     gcatttgcca gcggcggcaa gatacccaag cgcgctgcat tcgccaagca ggaaattcat       780
     gatgatacta cgcccagcac caatgcatac gctgtctata gcaccgctca agctgcgaag       840
     aaagctcccg cggcacttaa tggcaccgtt gtcttagatc gacacctgcg cgtcgataac       900
     gtggcgcatc ccgccaaggt cgaccataag cgctgcgtat tcgtcggtaa tctcgacttc       960
     atcgacaacg aaaccggcac cgaagaaggc gagaaaaaga agaaaaaccg acctccggct      1020
     gacgtggagg agggtctctg gcgtactttc aatgctcaca ccaaagcgtc acaaagtggt      1080
     cctgccggcc gaggcaatgt tgagtctgtg cgggtagtcc gtgaccgatc cactcgtgtt      1140
     ggaaaaggat tcgcatatgt tcaattttat gaccagaact gtgtcgagga ggctctcctg      1200
     cttaacgaca agaggtttcc cccattgtta ccacgaaagc ttcgcgttgt cagagcgaag      1260
     aaggtagcca agaagtctgt tgagaccaca ggtgcaccta aggggtcgga ccggacacta      1320
     caaggccgtg ctgggaagtt acttggaagg tcaagtgagg ctcggttgaa ggcggcggcc      1380
     aagaagtcga tttcccagag ctccctagta tttgagggca accgcgcaac agcagatggg      1440
     tcatcccgca ttcgagtgcg gacgaagagt cgcggctcca aggccaaaaa ggatagtcga      1500
     agcaagaagc gtgctgcggc ctataaagct gctgggggca aaaaggcgaa aattggcaag      1560
     tag                                                                    1563
//

If you have problems or comments...

PBIL Back to PBIL home page