(data stored in ACNUC16935 zone)

EMBL: BN001307.PE281

BN001307.PE281       Location/Qualifiers
FT   CDS_pept        join(771679..772237,772269..772559,772615..772681,
FT                   772743..773229,773300..773929)
FT                   /locus_tag="ANIA_01453"
FT                   /old_locus_tag="AN1453.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008066"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008066"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008066"
FT                   /db_xref="GOA:Q5BDC7"
FT                   /db_xref="InterPro:IPR013907"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDC7"
FT                   /protein_id="CBF84886.1"
FT                   /translation="MEVAETREPTTVGAPNGTDETVVNGDQNLFYQDSLLDDGRSSSLS
FT                   EIDDVLENMPSDYESPKPEKIATENDSEAETERIDDSPNNYRTRTNIVLSATSYGPSPS
FT                   KLVHSTTYDDVEEDDVHPADESPSKPRSKNDRTVDSVEEVQEPDDSNLSDSAGKKRKRP
FT                   ESGDELISELDEDDFPPHKRRGSNLALTPEPVEEEVPKVNQEDTLADDIPESDLPSAPT
FT                   KSKRTRKGKRKGRKTRDVDDDAESGAVEMGAEVDDTPADEDAADRPDDADDGEAAAKLE
FT                   EESKRTSAMDSLAVLEREFATLRDKIYDERISKLNRELDMLKGPNPTHPELLRQLDCIK
FT                   GYRDAKIKYEHTLFQYRLKSLLNKSQAERAQAHSTYFQRARDIREHHSSAISKQFYSIQ
FT                   HDRFKTDDVSPQHYIPFPTRRSQQIAHQTAYNQEVSVLAGVAKYVGFPAAPSLSSARPA
FT                   ELDEDLEKMGISFETKAPASHHQSTIPRATIPSMSSNVHPTSAEEAFLEQTPWANPQHP
FT                   YHQHQNLSHRPQNRIMDNSRMSAFATPAGQMRVVDVNAPNGSASTIAENSSANNTPYGL
FT                   EQDNSTAATKPYLDYDARLRSLSSSPTDVRKPHPAMYTSLDHRPPQGIPRNPGYSSPPS
FT                   RLVFGSAPKQDTSPSISSKPVNSLHQPAAMLGSTSQNQMAAR"
     atggaggtag cagaaaccag agagcctact acggttggtg cgcctaacgg caccgacgaa        60
     accgtcgtca atggcgatca aaacctgttt taccaggatt cgttactcga tgacggacga       120
     tcgagcagtc ttagcgaaat tgatgatgtg ctagaaaaca tgccgtctga ttacgagtcg       180
     ccaaagccag agaagattgc tacagagaac gattcagagg cagaaacaga gcgcatcgac       240
     gactctccga acaactaccg cacccggaca aatatcgtgc taagcgcaac cagttatggt       300
     cccagtccca gcaaattagt tcattcgacc acttacgacg acgtggagga ggacgacgtt       360
     catccggcag atgagtcgcc aagcaaacct cgctcgaaaa atgatcgtac cgtagatagc       420
     gtcgaggaag ttcaggaacc tgatgactcc aacttgtctg atagcgctgg gaagaaaaga       480
     aaacgccctg agtccggaga tgaattgatc tccgagctcg atgaagatga tttcccgccg       540
     cacaagcgtc gtggctccaa cttggccctt actccggagc cggttgagga agaagtaccc       600
     aaagttaatc aggaggatac cttggccgat gatattcctg aatctgacct accttcagct       660
     ccgacgaaaa gcaagagaac cagaaagggt aaacggaaag gacgcaaaac tagagacgtt       720
     gacgatgatg ctgagagcgg cgccgttgaa atgggtgcgg aggttgatga tacacctgcg       780
     gacgaggatg cggcggaccg tccagacgat gctgatgatg gtgaggctgc cgccaaacta       840
     gaagaagaat ccaaaagaac atcggctatg gactctctgg cggtcttgga gcgagaattc       900
     gcaactctcc gtgacaagat ttatgacgaa aggatatcca agttgaaccg tgaattggat       960
     atgctcaaag gtcctaatcc gacacatcca gagcttctgc gacaacttga ttgtatcaaa      1020
     gggtatcgcg acgctaagat caagtacgaa cacactttgt tccagtatcg ccttaagtcc      1080
     ttgctcaaca aaagccaagc cgagcgtgcc caggcacata gcacgtactt tcaacgggcc      1140
     cgcgatattc gtgaacatca ctcgagtgct attagcaagc aattctactc gattcagcat      1200
     gatcgtttca agacggacga tgtgagccct caacattaca ttccgttccc gacacgccgt      1260
     tcccaacaga tcgcgcatca aactgcatac aatcaagagg tgtccgtatt ggcgggagtt      1320
     gcgaaatatg ttggttttcc ggccgcccca tcgctatcat ccgcgcggcc agcggagctt      1380
     gacgaggacc tggaaaagat gggcatatct tttgaaacga aagctcctgc gtctcatcat      1440
     cagtcaacaa taccccgagc caccatacca agcatgtcat caaatgttca ccccacatcc      1500
     gccgaggaag ccttccttga acagacacct tgggcaaacc cacaacatcc ttatcatcaa      1560
     catcagaatc tgtctcatag accgcagaat cgtattatgg acaattcccg tatgtctgcg      1620
     ttcgctacgc cagcaggtca gatgcgcgtg gtggacgtca atgctccgaa tggatctgcc      1680
     tcgacaattg cggagaattc ttctgccaac aatacacctt acggcttgga gcaagacaat      1740
     tcaacggcgg ctaccaagcc gtatcttgat tacgatgcga ggctccggtc tctcagttct      1800
     tcacccacag atgttcgaaa acctcaccca gctatgtata cctccctcga tcaccgacca      1860
     cctcaaggta tcccgcgaaa tcctggatac tcatcccctc cttctcgact tgtctttgga      1920
     tccgcgccga aacaggatac atcaccatcc atatcgtcca agcccgtcaa ctccctacat      1980
     caaccggcag caatgctagg aagcacgagt caaaatcaaa tggctgctcg atag            2034
//

If you have problems or comments...

PBIL Back to PBIL home page