(data stored in ACNUC16935 zone)

EMBL: BN001307.PE283

BN001307.PE283       Location/Qualifiers
FT   CDS_pept        join(778028..778051,778124..778307,778399..778469)
FT                   /locus_tag="ANIA_11303"
FT                   /old_locus_tag="AN11303.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008068"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008068"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008068"
FT                   /db_xref="GOA:C8VMC2"
FT                   /db_xref="InterPro:IPR008386"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMC2"
FT                   /protein_id="CBF84890.1"
FT                   /translation="MAASQGVNVLRYSALVAGLVYGFYHQSSITAANRRAEAEREYARQ
FT                   ERLIEQAKAEWKKKTQPQDSKSTGVITDPEDPKFDLEAFLKLKAGEA"
     atggctgctt cacaaggtgt caatgttctt cgttactcgg ctctcgtagc tggtctcgtt        60
     tatggtttct accatcagtc ctctattact gctgccaaca gacgtgccga ggccgaacgc       120
     gaatatgccc gccaggagcg cctgatcgaa caggccaagg ccgaatggaa gaagaagacg       180
     caacctcagg acagcaagtc aacgggtgtc attacggatc ccgaggaccc gaagttcgac       240
     cttgaggcat tcctgaagct gaaggccggt gaggcttaa                              279
//

If you have problems or comments...

PBIL Back to PBIL home page