(data stored in ACNUC16935 zone)

EMBL: BN001307.PE284

BN001307.PE284       Location/Qualifiers
FT   CDS_pept        complement(join(778940..779172,779174..779203,
FT                   779259..779437,779499..779695))
FT                   /locus_tag="ANIA_10208"
FT                   /old_locus_tag="AN10208.4"
FT                   /product="COP9 signalosome complex subunit 8 (CSN complex
FT                   subunit 8) [Source:UniProtKB/Swiss-Prot;Acc:P0C624]"
FT                   /note="transcript_id=CADANIAT00008069"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008069"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008069"
FT                   /db_xref="GOA:P0C624"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR033464"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0C624"
FT                   /protein_id="CBF84891.1"
FT                   /translation="MDLPPLSLDQLSAVITAGPTPTDLYTSLSAYEEQACLLSATDPSE
FT                   KDLLLEFYTAFFFSHLLTDQICEARALTRRIPREISRLDAMQTCSLLLRAVWQSKHTEI
FT                   YKILRELPWPGRSQPLVQRYESYFQEKTLVEMSNSYETIRIAAAATYLGLDPAAVEGDI
FT                   IEKFTACGWKWDSEKQLLHPKPVVTAPPKDDSLQNELSRVMALISNQGS"
     atggacctcc ctccgctttc tctggatcag ctctccgcag ttatcacagc tggtcccacg        60
     cccactgatc tttatacctc attatcggcc tatgaagaac aagcgtgcct cctctcggct       120
     acagacccca gcgaaaagga cctactgctc gaattttaca ctgcgttctt cttttcccac       180
     cttctcacgg atcagatttg cgaagcccgt gctttaacac ggcgaatacc acgagaaata       240
     tcacgactgg atgccatgca aacctgttcg cttctcttgc gagctgtttg gcaaagcaag       300
     cacactgaaa tttacaaaat tctccgagaa ttaccctggc ctgggcggtc gcaaccctta       360
     gtacaacgtt atgagagcta tttccaagaa aagacgctgg tagaaatgag caattcttac       420
     gagacgatac ggatcgctgc cgccgcaaca tatctcgggc tcgacccagc tgccgttgag       480
     ggtgacataa tagagaagtt cacagcctgt ggatggaagt gggatagtga gaaacagcta       540
     ctacatccaa aacccgtcgt caccgcccct ccgaaagacg atagcttgca gaatgaactg       600
     agccgtgtaa tggctttaat cagcaatcaa ggcagctga                              639
//

If you have problems or comments...

PBIL Back to PBIL home page