(data stored in ACNUC16935 zone)

EMBL: BN001307.PE285

BN001307.PE285       Location/Qualifiers
FT   CDS_pept        join(780014..780143,780217..780240,780340..780420,
FT                   780522..781115,781165..782290,782347..782617)
FT                   /locus_tag="ANIA_01455"
FT                   /old_locus_tag="AN1455.4"
FT                   /product="hypothetical protein similar to oligosaccharyl
FT                   transferase (Eurofung)"
FT                   /note="transcript_id=CADANIAT00008070"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008070"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008070"
FT                   /db_xref="GOA:C8VMC4"
FT                   /db_xref="InterPro:IPR003674"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMC4"
FT                   /protein_id="CBF84893.1"
FT                   /translation="MAESPVDVLLKGSSGRSARGLLRIIILVTIAAAAVSSRLFSVIRF
FT                   ESIIHEFDPWFNFRATKYLVQNGFYDFWDWFDDRTWHPLGRVTGGTLYPGLMVTSGVIY
FT                   HILRFLTFPVDIRNICVLLAPGFSGLTAFAMYLLTNEMSSSPSAGLLAAAFMGIAPGYI
FT                   SRSVAGSYDNEAIAIFLLVFTFFLWIKAVKNGSIMWGALAALFYGYMVSAWGGYVFITN
FT                   LIPLHVFVLLCMGRYSPRLYISYTTWYALGTLASMQIPFVGFLPIRNSDHMSALGVFGL
FT                   LQLVAFAEFVRSYIPGKQFQRLLTASIILITGLAFAGLVVLSMSGIIAPWSGRFYSLWD
FT                   TGYAKIHIPIIASVSEHQPTAWPSFFFDLNFLIWLFPAGVYMCFRDLRDEHVFVIIYAV
FT                   LASYFAGVMVRLMLTLTPIVCVAAALVLSYILDTYLKTSPGPVTRGRSNDESSEGLRSA
FT                   RSPEVGITSYFSKAVTTSAAIVYLLLFVAHCTWVTSNAYSSPSVVLASRMPDGSQFIID
FT                   DYREAYYWLRQNTPANAKIMSWWDYGYQIGGMADRPTLVDNNTWNNTHIATVGKAMSSR
FT                   EEVSYPILRQHDVDYVLVVFGGLLGYSGDDINKFLWMVRIAEGIWPDEVKERDFFTARG
FT                   EYRVDDQATPTMRNSLMYKMSYHNFNKLFPMGQATDRVRGAKLPAESPQLSTLEEAFTS
FT                   ENWIIRIYKVKDLDNLGRDHSNAVAFDRGNKRKKASKRKGPRVLRSE"
     atggccgaat ctcccgtaga tgtccttctt aagggcagct ccggcagaag tgcgcgcggc        60
     ctgctacgta tcatcattct agtgaccatt gcagccgcag ccgtttccag tcgactgttc       120
     agtgtcattc gtttcgaaag catcatccac gaattcgatc cttggttcaa tttccgcgca       180
     actaagtatc tggttcagaa tggtttttac gacttttggg attggttcga tgaccgcaca       240
     tggcatcctc ttggtcgggt taccggaggc acattgtacc ctggacttat ggtgaccagt       300
     ggtgtcatct atcacatact ccgattcctg acctttcccg tcgacattcg caacatatgt       360
     gtcttactag cacccggttt ctccggcctg acggcgttcg caatgtacct cttaaccaat       420
     gagatgtcct cctctccctc tgcaggtctt cttgcggccg ctttcatggg cattgcccct       480
     ggatacatat ctcgttccgt ggccggaagc tacgacaatg aagccattgc catattcctc       540
     ctcgttttca ccttcttctt atggattaag gcggtcaaga acggttccat tatgtgggga       600
     gcactggctg ctctgtttta tggctacatg gtctccgcct ggggtgggta tgtattcatt       660
     accaacttga tccccctgca tgtctttgtc ctgctctgca tggggagata tagccccagg       720
     ctgtacatca gttacacgac atggtatgcg ctaggaactc ttgccagcat gcaaattcct       780
     tttgttgggt tcctgccaat ccggaacagt gaccacatgt ccgccctggg tgtctttggc       840
     ttgctacaac ttgtggcctt cgcggagttt gtgcgcagtt acattcctgg caagcagttc       900
     cagagactgc tgactgcctc catcatccta attacaggcc tcgccttcgc ggggcttgtt       960
     gtcttgagca tgtcagggat tatcgcccct tggagcggtc gtttctattc actgtgggat      1020
     accggctatg ccaaaatcca cattcccatt attgcttcgg tctcagagca tcagcccacc      1080
     gcttggccat cattcttctt cgatctcaac ttcctaatct ggctcttccc tgcgggtgtt      1140
     tacatgtgct tccgtgatct cagagacgag cacgtgtttg tcatcatcta cgctgtcctt      1200
     gcgagctact ttgctggcgt tatggtacga ttgatgctga ccttgactcc tattgtgtgc      1260
     gttgcggctg ccctggtctt atcatacatt ctcgacactt atttgaagac ttcacccggc      1320
     ccggttacac ggggaaggtc taacgatgaa tcctccgaag gtctccgttc tgccaggtct      1380
     cctgaagtcg gaatcacttc ttacttctcc aaagctgtca cgacatccgc cgctattgta      1440
     taccttctcc tgttcgttgc gcactgcacc tgggtgacat cgaacgccta ttcatctcca      1500
     tctgtcgtcc tggcgagccg gatgccggac ggaagccaat ttatcatcga cgattaccga      1560
     gaggcttact actggcttcg ccagaacacc cccgcaaacg ccaagatcat gtcttggtgg      1620
     gattatggtt accaaatcgg cggcatggca gatcgcccaa cgcttgtcga caacaacacg      1680
     tggaataaca ctcatattgc tactgtcgga aaggccatga gctcacgcga ggaagtcagt      1740
     tacccaattc tccgccaaca tgatgttgac tatgtcttgg tggtttttgg tggattgtta      1800
     gggtattctg gtgatgatat caacaaattc ctttggatgg tccgtatagc agaaggtatc      1860
     tggcccgacg aggtaaagga gcgagatttt ttcaccgcga ggggagagta ccgcgtggac      1920
     gaccaagcca ccccaaccat gcgcaacagc ttaatgtaca aaatgtcgta ccacaacttt      1980
     aacaagctct tccctatggg ccaggctact gaccgtgtcc gcggagccaa gcttccggcc      2040
     gagagccctc agctctctac tctggaagaa gccttcacca gtgaaaactg gattatccgc      2100
     atctacaagg tcaaggatct cgacaacctg gggcgggacc acagcaacgc cgtcgccttt      2160
     gaccgcggga acaagcggaa gaaggcgagt aagcgaaagg gacctcgtgt tctgaggtcg      2220
     gaataa                                                                 2226
//

If you have problems or comments...

PBIL Back to PBIL home page