(data stored in ACNUC16935 zone)

EMBL: BN001307.PE286

BN001307.PE286       Location/Qualifiers
FT   CDS_pept        complement(join(783169..783263,783336..783460,
FT                   783576..783589))
FT                   /locus_tag="ANIA_11304"
FT                   /old_locus_tag="AN11304.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008071"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008071"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008071"
FT                   /db_xref="GOA:C8VMC5"
FT                   /db_xref="InterPro:IPR018628"
FT                   /db_xref="InterPro:IPR041752"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMC5"
FT                   /protein_id="CBF84895.1"
FT                   /translation="MPAGIFNSTYYGKDYRAGAALLRARRPYLFKNAATGLGLCMFTIG
FT                   VYAYTIRAVGQDEFSDVKVPDAPAAAPQQSKQ"
     atgccagccg gaattttcaa ctccacatac tacggtaaag actaccgtgc cggtgctgct        60
     cttctccgtg cgcgccggcc atatctcttc aagaatgccg cgaccggact tggcctttgc       120
     atgttcacaa tcggtgtcta cgcatacaca attcgcgctg tcggccagga tgagttctct       180
     gacgttaaag ttcccgacgc ccccgccgcc gcgccacaac agtcaaagca atga             234
//

If you have problems or comments...

PBIL Back to PBIL home page