(data stored in ACNUC16935 zone)

EMBL: BN001307.PE287

BN001307.PE287       Location/Qualifiers
FT   CDS_pept        join(784455..784792,784949..785114,785172..785302,
FT                   785369..785572,785621..785969,786019..786839,
FT                   786893..786963,787020..787186)
FT                   /locus_tag="ANIA_01456"
FT                   /old_locus_tag="AN1456.4"
FT                   /product="mRNA cleavage and polyadenylation specificity
FT                   factor complex subunit (Pta1), putative (AFU_orthologue;
FT                   AFUA_8G04420)"
FT                   /note="transcript_id=CADANIAT00008072"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008072"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008072"
FT                   /db_xref="GOA:C8VMC6"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR021850"
FT                   /db_xref="InterPro:IPR032460"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMC6"
FT                   /protein_id="CBF84897.1"
FT                   /translation="MAQSGDQVTDQIAQLNAARNLVLGDAAFYPQIVNGVLPIIGAHAR
FT                   VELRRWGTEFLAETFASPAFATAPKEQLAINVLQTVRSILELPEGDQLVLQNITQTAAS
FT                   LYPLVFRHIINHPEDKQSWEHIEAIKQDLLRRWDSFPCPVKVCCIKFAQRVVLTQTHGP
FT                   IADPRRPDKNETSLAIVPRNHAILSLPNLEAESSGLLDRILSIFQEDASDPVLVNATLN
FT                   CLAVVIRTRQSIGNKIINAILNFFPARHMRLPVTPAVRIGVKSMERTARAVFINIMKRN
FT                   PSHPLAGKMQQHIERLMQSRIEQVDDTSRKRGLPTEPTDGLDAAKRARLDAETPPIIKV
FT                   PPLPPGRISFAQLFTLTEDSGLSSFDVKQLPADLVVKIAVPLLARVDQSLLGQAVDAIR
FT                   MRYQTVQKQQMTQPQLAAEEDDDDYEPEYQPMDIPASAADETGAVLAAVQEEQTDLVSL
FT                   GPFVLPRPPPLTEEQAAEAGRSAVARVFGMLGSTTLTPNPVKGQGQRLGFSRLAGSTFD
FT                   RDAWVTLLTRLATRAPAGLEGPKQETDSLGRKKPTISDTIRESLYRYILEDFRGRVNIG
FT                   IMWLNEEWYNDRLQMKVASSNRTDEDEEISVPLHYDHWVLRLLDGFLPYLDSRDNKVFI
FT                   RFLSEIPEVTIHIAKRIASLAKDPERVNLCVQSFMYLIMFRPPAREICLDALEEVYQNY
FT                   EESRPSAGKVLSRWRPQRVEQLQAEQTTLVNRTVDNTTITNGSRDPRTAHVAAS"
     atggctcagt cgggggacca ggtcaccgat cagatcgcgc agctgaatgc tgcccgtaat        60
     ctcgtcctag gagacgccgc tttttatcct cagatcgtca acggagtcct tccgattatt       120
     ggtgcgcacg cgcgagtgga attgcgacga tggggaaccg agttcctggc cgagacgttc       180
     gccagtccag cgttcgctac ggccccgaag gaacagttgg cgatcaatgt gttgcagacg       240
     gtacggagca tattggaact gccagaaggg gatcaattgg tcttgcagaa tattacccag       300
     acagccgcca gtctatatcc cctggttttt aggcatatca tcaaccatcc ggaagacaag       360
     caatcctggg agcatatcga agcaatcaaa caggatctcc tgcgaaggtg ggactcgttc       420
     ccatgccccg tcaaagtttg ctgcatcaaa ttcgcccaac gggtcgtcct cacacaaacg       480
     catggcccga tagcggaccc caggcgaccc gacaagaatg aaacatccct agcgatagtt       540
     cctcgaaacc acgccattct ctctctcccc aatctagaag cagaatcctc cgggctatta       600
     gataggatcc tatccatttt ccaggaagac gcaagtgatc ccgtccttgt gaatgcgacg       660
     ttgaactgcc tagcagtcgt catccgaacg cgacagtcca ttggcaacaa gatcatcaat       720
     gctatcctta acttctttcc cgcacgacac atgcgcttgc cggtgacacc tgcggtccga       780
     atcggagtca aatctatgga aaggacagct cgggctgtat ttataaatat tatgaagagg       840
     aatccgagcc accctctcgc gggtaagatg cagcaacata ttgagcgact catgcaatcc       900
     cgcatagagc aagttgatga tacctcacgg aaacgaggat tgccgactga accaactgat       960
     ggcttggatg ccgctaaacg ggcaaggctt gatgctgaga caccaccaat catcaaagtg      1020
     ccacctcttc ccccaggtcg gatcagcttt gcccagctgt ttactctaac tgaggactct      1080
     ggcctctctt cgttcgatgt gaaacagtta cccgcggacc tcgtagtcaa gatcgctgtg      1140
     cctttattag cgcgagtgga ccagtcacta ttgggccagg ctgttgatgc tatccggatg      1200
     cgataccaaa cagttcagaa gcaacaaatg acccaaccgc agctggccgc tgaggaagac      1260
     gatgatgact acgagcctga ataccagcct atggacattc cagcgtcagc ggcggacgaa      1320
     actggggcgg tattagctgc tgtgcaagag gagcagactg atctcgtgtc tttgggacca      1380
     tttgttttgc cacgtccccc tcctctgact gaggagcaag cagcggaagc cggccgaagt      1440
     gccgtggcaa gagtcttcgg catgttaggg tcaactacgt tgaccccgaa tcccgtaaaa      1500
     ggtcaggggc aacgactggg tttctccaga ttggcaggta gcacattcga tcgtgacgca      1560
     tgggtaactt tactcacccg gcttgcaact cgagctccgg ctgggttaga gggaccgaag      1620
     caggaaacag acagtttggg caggaagaag cccacgatat cagatacaat acgagaatct      1680
     ctctatcgct atatacttga agacttccgg ggccgagtca acattggcat tatgtggctg      1740
     aacgaggagt ggtataacga ccgccttcag atgaaggttg cttcttctaa tcgaaccgac      1800
     gaagatgagg agatttcggt gccgctgcat tacgatcatt gggtcctgcg gctactggac      1860
     gggttcttac cgtacctgga ctctcgcgat aataaagtct tcattagatt tctaagtgaa      1920
     atccccgaag tgacgatcca catcgccaaa cgcatcgcta gtcttgctaa ggacccggag      1980
     agagtaaacc tctgcgttca atcctttatg tacctgataa tgttccgccc tccagcacga      2040
     gaaatctgtc tcgatgccct agaggaagtt tatcaaaatt atgaggaatc ccgtccttcc      2100
     gctggtaagg tcctgtctcg atggcggccg caaagagttg aacagctcca agccgagcaa      2160
     acaaccctag tcaaccgcac agtcgataac acaacaatca caaacggttc cagagaccca      2220
     agaaccgcac acgttgcagc ttcctga                                          2247
//

If you have problems or comments...

PBIL Back to PBIL home page