(data stored in ACNUC16935 zone)

EMBL: BN001307.PE289

BN001307.PE289       Location/Qualifiers
FT   CDS_pept        791665..792756
FT                   /locus_tag="ANIA_01458"
FT                   /old_locus_tag="AN1458.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008074"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008074"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008074"
FT                   /db_xref="GOA:C8VMC8"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMC8"
FT                   /protein_id="CBF84901.1"
FT                   /translation="MVEFIPPPDPRDLLPPLLACLPTAFVSQKPPPALLPLLSPILRQR
FT                   VQILSSVSTSSSESWLRLLCWDSEKGERLQSLIDGASFEPHPVSGEIELPDDIPVTYRR
FT                   LDEETLQSRVLIPEYELKVVYLWCPKEESPGWRIAEVLPHQGLGEDDGVWSSTIGDANT
FT                   HAKEKLVEDALKAAERDDHIAPQEEDDDDDDYWARYDATPGRTPSVKNSAPPALTSMLQ
FT                   HHGPSESSYFSQYDDVQPVMDNHDPDEEHPELGPSSLGGDILTELAKRNTDSESHEHMN
FT                   QTNGASLNHPRPESATSSNPEAVSRLEQEAENQSAYEIGVKQHIGSNIKSLFRLAKATG
FT                   ISRADFQSLVKTELDLLNLSDDD"
     atggttgaat ttatcccacc tcccgatccc cgtgaccttc tgcctccgct gctagcatgt        60
     cttccaacgg cgtttgtctc tcagaaaccc ccgccagctc ttcttccgct cttatcaccc       120
     attctacgcc agagagttca gattcttagt tcagtgtcga cttcgtcgag tgagtcatgg       180
     cttcggctac tatgctggga ttcagaaaag ggtgagcgcc tccaatctct gatcgatggt       240
     gcgagcttcg agcctcaccc ggtgtctgga gaaattgagc tgcccgatga tatcccggtg       300
     acatacagaa ggctggacga ggagacactc caatcacgcg tgcttatacc ggaatatgag       360
     cttaaagtcg tgtatctttg gtgcccgaag gaggagtctc cgggttggcg cattgccgaa       420
     gtccttcctc accaaggtct gggagaagac gacggggtct ggtcgtctac tatcggggat       480
     gcgaacacac atgcgaagga gaagttggta gaggatgcgt tgaaagcagc ggagagggat       540
     gatcacatag cacctcagga ggaagacgac gatgacgatg actactgggc tcgatacgat       600
     gccacacccg gacgcactcc ttcagtgaag aattctgctc cgcctgcgtt gacgtctatg       660
     ctgcaacacc acggcccatc tgaatcatcc tacttctccc aatatgacga tgtgcagcct       720
     gtgatggaca atcatgaccc agatgaagaa cacccggagc ttggaccgtc ttcacttggt       780
     ggagatatac tcacggaact tgccaaacgg aataccgact cagagtctca tgaacatatg       840
     aatcagacaa acggagcgtc attaaaccac ccccgaccgg aatccgcgac gtcttcaaac       900
     ccagaggcag tctcaagact cgagcaggaa gctgagaacc agtctgcata cgagatagga       960
     gtgaagcaac acatcggctc caatattaag agcttgttcc gcctcgccaa agcgacgggt      1020
     atctctcgag ccgatttcca atccctagtc aagaccgagc tggatctctt gaatttgtct      1080
     gacgacgact ga                                                          1092
//

If you have problems or comments...

PBIL Back to PBIL home page