(data stored in ACNUC16935 zone)

EMBL: BN001307.PE29

BN001307.PE29        Location/Qualifiers
FT   CDS_pept        join(80729..80922,80986..81404,81461..81601,81655..81869,
FT                   81935..82132,82186..82329,82497..82562)
FT                   /locus_tag="ANIA_09033"
FT                   /old_locus_tag="AN9033.4"
FT                   /product="amino acid transporter (Eurofung)"
FT                   /note="transcript_id=CADANIAT00007820"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007820"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007820"
FT                   /db_xref="GOA:Q5ARP7"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARP7"
FT                   /protein_id="CBF84423.1"
FT                   /translation="MPFHADIPQFQPTNDDIERTQAEKKHKETPTMAVDEQKAESVPYR
FT                   QDVFGDEEHAEVKYKVLKWWQCGLLMVAETISLGILSIPAAIAGLGLVPAIVILLVMGL
FT                   IASYTGYVIGQFKWRYPHVVSMADAGEVLMGRFGREVLFGGQMLFLIFLMASHILTFTV
FT                   AMNRLTNHGTCSLVFGVIGLLVSLVFSLPRTMKNMSWLSLASFISIFTAVMIAMVAIGV
FT                   EHPGGPVKATAETNLVTGFTAALNIILSYASHNAFFNVIAELKEPRDFPKALTLLQCID
FT                   ITLYLVSGVVIYYFAGDDVKSPALGSINPLVSKVAYGVALPTIIIAGVINGHIACKSIY
FT                   TRVFAGTSHMHKQDFRAVGSWIGIAVGLWVIAWVVATAIPVFSNLLSLMTALFASWFSF
FT                   SLPAAFWLFMNRGLWFSSPRKTGITIFNCLVFGMGVVMSLGTILLACICVSSGNGKSSS
FT                   "
     atgcccttcc acgccgacat cccccaattc caaccaacaa atgacgatat cgagcgcact        60
     caagcggaga agaagcacaa ggaaaccccc acgatggccg tcgacgagca aaaggctgag       120
     agcgttccat accgacagga cgtctttggc gacgaggagc acgccgaagt caagtacaaa       180
     gtcctcaaat ggtggcaatg cggactcctc atggtcgccg aaacaatatc cctgggcatt       240
     ctctccatcc cagccgcaat cgcaggtctt ggcctcgtcc cggccatcgt gatccttctc       300
     gtcatggggc tcattgcttc atatacgggc tacgtgatcg ggcaattcaa gtggcggtat       360
     ccgcatgtcg tcagcatggc tgatgcaggt gaggtcctga tgggccggtt cgggcgagag       420
     gttctcttcg gcggccagat gctcttcttg atcttcctca tggccagcca tatcttgaca       480
     ttcacagtgg caatgaacag actgaccaac cacgggacat gttctcttgt ctttggggtt       540
     attgggctgc tggtttctct tgtgttttcc ctgcccagga caatgaaaaa tatgtcgtgg       600
     ctgtcgcttg cttcatttat cagtattttc acagcggtca tgatcgccat ggtcgccatc       660
     ggtgtcgagc accctggagg cccagtcaaa gccacagccg agacaaatct tgtcactggc       720
     tttacagctg cgctgaatat catcctgtca tacgcgagcc ataacgcctt cttcaacgtc       780
     atcgctgagt tgaaagagcc cagagacttc cccaaagccc tcaccctgct gcagtgcatt       840
     gacattaccc tttatcttgt ttccggtgtc gtgatctact acttcgccgg ggacgacgtc       900
     aagtccccag cactcggctc aataaaccca ttggtgtcta aggttgctta cggggtggct       960
     ctaccaacaa ttatcatcgc cggcgtgatt aacgggcaca tcgcgtgtaa gtccatctac      1020
     acacgcgtct tcgccggcac ctcccacatg cacaagcagg atttccgggc cgtgggatcc      1080
     tggatcggta ttgcggtggg actttgggtc atcgcctggg tggttgcgac tgcgattccg      1140
     gttttcagta accttcttag tcttatgact gcgctcttcg ccagctggtt cagcttcagt      1200
     cttcctgctg cgttctggct gttcatgaac cgtggcctgt ggttctcgag cccaaggaaa      1260
     actggaatca ccatctttaa ctgccttgtt ttcgggatgg gtgttgttat gtctttgggt      1320
     actatcttac tggcttgtat atgtgtttcg agtggtaacg gaaagtcttc ttcgtga         1377
//

If you have problems or comments...

PBIL Back to PBIL home page