(data stored in ACNUC16935 zone)

EMBL: BN001307.PE292

BN001307.PE292       Location/Qualifiers
FT   CDS_pept        join(797893..798006,798060..799475)
FT                   /locus_tag="ANIA_01461"
FT                   /old_locus_tag="AN1461.4"
FT                   /product="Protein OS-9 homolog Precursor
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5BDB9]"
FT                   /note="transcript_id=CADANIAT00008077"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008077"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008077"
FT                   /db_xref="GOA:Q5BDB9"
FT                   /db_xref="InterPro:IPR009011"
FT                   /db_xref="InterPro:IPR012913"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5BDB9"
FT                   /protein_id="CBF84906.1"
FT                   /translation="MRRQSRIVASLLVLACASSGAFAHRKFNVHDDLLAYPQFRIKFPD
FT                   GFILESQARAFLEQAPYSSPDLNDISEQTPLKDESEESIRDGSSGEKAKFSYEELSLEG
FT                   QRYLCQIPVVEDGDSNRTKVEVNEEEERKELARATDRGLELLREMEGKCLYYISGWWSY
FT                   SFCYMNQIKQFHALPSGGGVPNYPPMEDHTTHSFILGRFPQEEGQDEGKGAKSGKSSTE
FT                   LAELQTKGGSRYLVQRLESGDQCDLTGKNRKIEVQFHCNPQSTDRIAWIKELYTCSYLM
FT                   LIYTPRLCNDVAFLPPQQEEVHTIECREILTPEEVTGWQAMHEYQLSQQLVESAEAPKH
FT                   QVIGGIEVGAQRLVGTEGKRIEKGRVASIGEEKVDVVAKRVNGEVQLLSAEELKKFDLD
FT                   EAKIEELRKKLEEWAKGKDWTLEIVTGNGAYLRGVVDTDEDEEDGYENEEGETDKREQR
FT                   ENTQETTGQPGQPGHQEETESGQAGHPMDDRSEDGEDPDVDGSEEIFKDEL"
     atgcgcagac agtcgagaat agtagcctct ctgcttgtgc tagcatgtgc aagctccggc        60
     gcattcgcgc acaggaagtt caatgttcat gatgatctac tagcataccc tcagttccgt       120
     atcaaattcc ccgatggctt tatcctcgag tctcaagcac gcgcatttct agaacaagct       180
     ccctatagca gcccagacct gaacgatatc tctgaacaaa cgccgttaaa ggacgaaagt       240
     gaagaatcga tacgcgacgg atctagtgga gagaaggcca aattctcgta tgaggagctg       300
     tctctcgaag gacagcgata tctttgccaa atccctgttg tggaagatgg cgacagcaat       360
     cgaacaaaag tagaagtgaa tgaggaggag gagcgaaagg agctcgcgcg agcaacagac       420
     cgaggtttgg agctgctgcg tgagatggaa ggcaaatgcc tctactatat ctccggatgg       480
     tggtcttatt ccttttgcta catgaaccag attaagcagt tccacgcgct tccgtcagga       540
     ggtggtgttc ccaactaccc gccaatggag gatcacacga cgcactcgtt catactgggg       600
     agatttccgc aagaagaagg tcaggatgag ggaaagggtg cgaagtcggg gaagtcttcc       660
     acagaattgg cagaattgca gacgaaagga ggctcgcgct acctggttca gcgacttgaa       720
     agcggcgatc agtgcgacct cacaggaaag aatcggaaga ttgaagtcca gttccactgt       780
     aacccgcagt cgacagaccg tatcgcctgg atcaaagaac tctatacgtg ctcctacttg       840
     atgctcattt atacaccacg gctatgcaac gatgtcgcgt tccttccacc tcagcaagag       900
     gaggtccata ccatcgaatg ccgtgagata cttactccgg aagaggtcac cggctggcaa       960
     gctatgcatg agtaccagtt atctcaacag ctggtagaat ctgcggaagc acctaaacat      1020
     caggtcattg gtggtatcga agttggtgcc cagcggttag ttgggactga gggcaagcgc      1080
     atcgagaagg gccgtgtggc ttccataggc gaggagaaag tggatgtggt tgcgaaacga      1140
     gtgaacggcg aggtgcaact gctgtcggca gaggagttga agaaattcga cctcgacgag      1200
     gcaaaaattg aggagctcag gaagaagctg gaggaatggg ccaagggtaa agattggact      1260
     ctagagattg tgaccggcaa cggtgcatat cttcgtggag tggtcgatac agacgaagat      1320
     gaagaggatg ggtatgaaaa cgaagaggga gaaacggaca agagagaaca gagggaaaat      1380
     acacaagaaa ccacaggcca gcctggccag cctggccatc aggaagagac cgagtcaggg      1440
     caggccgggc acccgatgga tgacagatcg gaagatggag aggatccaga tgtggatgga      1500
     agtgaagaga tcttcaaaga cgaactgtag                                       1530
//

If you have problems or comments...

PBIL Back to PBIL home page