(data stored in ACNUC16935 zone)

EMBL: BN001307.PE293

BN001307.PE293       Location/Qualifiers
FT   CDS_pept        join(800254..800451,800623..801342,801380..801970,
FT                   802009..802057,802106..803890,803938..803963)
FT                   /locus_tag="ANIA_01462"
FT                   /old_locus_tag="AN1462.4"
FT                   /product="cytoskeleton assembly control protein Sla1,
FT                   putative (AFU_orthologue; AFUA_8G04520)"
FT                   /note="transcript_id=CADANIAT00008078"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008078"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008078"
FT                   /db_xref="GOA:Q5BDB8"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR007131"
FT                   /db_xref="InterPro:IPR013182"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="InterPro:IPR029922"
FT                   /db_xref="InterPro:IPR035800"
FT                   /db_xref="InterPro:IPR035821"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="InterPro:IPR038159"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDB8"
FT                   /protein_id="CBF84908.1"
FT                   /translation="MGFIGVYTAIYDYQPQAQGELELREGDLLYILEKSDEDDWWKAKK
FT                   KADREDEDEPEGLVPNNYVEEATPIHTAKALYDYTRQTDEEVSFSEDANLVVYDTSDPD
FT                   WTLVGVNGDFGFAPSNYIDILDDSVAHAAPAQTSASPEPPSAAAASPASPAPAPAPPSL
FT                   PQRPEPAPAEEPSSPVSSSPSDAVQNPAAAAIASILHKQHASSESPRDVPPPPQPQPPS
FT                   EPQYREPSPPPPQLPRRPPSEQLTSPVHLESPTFAPSPVSHPRHASIRENDGGPRESPP
FT                   YNRVGRTAPRSPSGYHIYNINEMVEGSTSPPGTIFISPEDDGDVQEWSAEKLTHYSIEG
FT                   KHVFIDLVRPSKSVDFHAGAKDTAREIVSALGEISGAFRAEGLREVIAAGSGGGGAQKK
FT                   GTILYDFMAQGDDEVTVGVGDEVVIVDDTKSEEWWMVRRIKNGKEGVVPSSYVEVTGFV
FT                   SPPSTTTPAESGLSAVERNRLEEARLAKEATRKSVSEAAAPRSPTIKPQHHKKDSKSSQ
FT                   RSKPDPAKVRTWIDRSKAFTVEAQFIGLQDGKIHLHKTNGIKIAVPIPKMSFEDLEYVE
FT                   KVTGISLDEDKPLSDIRRRSQRIESDKADKARSSSEGKSGATFQQSDYDWFDFFLKAGV
FT                   GPHQCERYAQNFAKDSMDESILPDITPENLRTLGLKEGDILRVMRYLDNMLGRTGNKSK
FT                   LRNVSFGGEEVMGDGEESGGLFAGPGGALRNNTRKSRPAPAVQTNDVVDPKVFEQKDTA
FT                   KPDKPPSSGTPPPASAAAGDKPVQKGFDDDAWEVKTPKQPAAPATAVSSPPPAAAPATT
FT                   SPPAQPSITGAMADLSLLQAPLQPTLAQPTSTPAPAQSPPATQPIQAQPTAIPAPQPQQ
FT                   PGASPNFFAQVAQVGQQQPMQTGFQQSRQRPQAPQVMGQNSLIPPPPQRPLSAPQNMPQ
FT                   QQPFGLPQLQPQLTGLPQQGPQIAAPGQSLAEINQQRFQPSFQPQQTGFMAPNQFQNGL
FT                   MPQPTGFQPQSQFGIQQQQTGFGLAPQPTGFGGFGAPPQQPMPTGINSVLPPPLQPQPT
FT                   GMNGSGSMAYSPSPPPIPPIPQQQTLAPLQAQKTGPAPPVRFGVKPDAPKKLAPQPTGL
FT                   KANLSQATPTNPFGF"
     atgggtttca tcggtgttta taccgccatc tacgactacc aaccgcaagc gcaaggtgaa        60
     ttagaacttc gtgaaggcga tctactatat attctcgaga agagcgacga ggacgattgg       120
     tggaaggcca aaaagaaggc ggaccgggag gacgaagatg agcctgaggg tctagtacca       180
     aataactacg tcgaggaggc cacgccgatt cacaccgcga aagccctcta cgattataca       240
     cgtcagacag atgaggaggt atctttctcg gaggatgcga acttggtggt gtacgacact       300
     tcggatccgg actggacctt ggttggagtc aatggggatt ttggattcgc tccgtcaaat       360
     tacatcgata tccttgacga ctctgtagct catgcagctc ccgcccagac ctctgcatcg       420
     ccggaacctc cttcggcggc tgcagcgtcc ccagcgtccc cagctcccgc accggcacct       480
     cctagcctcc cgcagcgtcc agagccggct cccgcggagg agcctagctc gcccgtctcg       540
     agctctccca gtgatgccgt gcagaatccc gctgcagccg ccatcgccag tatacttcac       600
     aagcagcacg cctcgtcgga atcacccaga gatgttcccc ctcccccaca gccgcagccg       660
     ccctcagagc cgcaataccg tgagccgtca cctcccccac ctcaattgcc gcgacggccc       720
     ccttcggagc agttgacatc tcccgtccat ctcgagtcac caacattcgc gccctcaccg       780
     gtttctcatc ctcggcatgc ttcgatacgg gagaacgatg gtggtccacg agaatcacct       840
     ccttataatc gggttggacg gacagcgccg cgctccccat ctggatatca catttacaat       900
     attaacgaga tggttgaggg atcaacatcg ccacctggaa ctatcttcat ttcaccggaa       960
     gacgatgggg atgtgcagga gtggagtgcc gagaagctta cccattactc cattgaagga      1020
     aagcacgttt tcattgatct cgtccgtcct agcaagagtg tggatttcca tgcgggagcc      1080
     aaagacacgg cgcgcgagat tgtctcggcg ttgggtgaga tctccggagc attccgcgca      1140
     gaaggcttgc gggaagtgat agcagcaggt tcaggcggcg gtggcgcaca gaagaaagga      1200
     actattcttt acgacttcat ggcgcaaggc gacgatgagg taacggttgg cgtcggtgat      1260
     gaggtggtga ttgtagatga taccaagtcc gaggaatggt ggatggttcg acgcatcaag      1320
     aatggcaagg agggagtagt tccaagcagc tatgtggaag tcaccggctt tgtctcccca      1380
     ccttcaacca ccactcctgc tgagtccggc ttgtcggctg tggagaggaa caggcttgaa      1440
     gaggctcgtc tagccaagga ggctacacga aaatcggtat cagaagcagc tgcaccacgc      1500
     agccctacga tcaagccgca gcaccacaag aaagacagca agagcagcca aagatccaaa      1560
     ccagacccgg ccaaggttag gacgtggatt gatcggtcca aggcattcac ggtggaagct      1620
     cagttcatcg gcttgcagga tggcaaaatc catttgcaca agacaaacgg aattaagatc      1680
     gcggtgccaa tccctaaaat gtcgtttgag gacttggaat acgttgagaa ggttaccgga      1740
     atctcccttg acgaagataa gccgttgtcc gacattcgtc gccgttctca acgtatcgaa      1800
     tccgacaagg cggacaaggc tcggtcctcg agcgaaggaa agtctggcgc tactttccag      1860
     cagtccgact acgactggtt cgactttttc ctcaaagccg gtgttggtcc tcatcaatgt      1920
     gagcggtatg cgcagaattt cgccaaagac tcgatggatg aaagtatcct tcctgacata      1980
     acccccgaga atctgcgcac actgggcttg aaagaaggtg atatcctgcg ggtcatgcgc      2040
     tatctggata acatgttagg gcggacaggc aacaagtcga agctgcgaaa tgtgagcttt      2100
     ggtggtgaag aggtcatggg tgatggtgag gaatctggtg gtctctttgc tgggcctggc      2160
     ggggcattgc gcaacaacac ccgaaagagc cgtccagcac cagctgtcca aaccaacgac      2220
     gtggttgacc cgaaagtgtt tgagcaaaaa gacacggcaa aaccagacaa accacccagc      2280
     agcggcaccc ctccaccggc ctctgccgct gccggcgaca agcctgtgca aaaaggattc      2340
     gacgacgatg cgtgggaagt caagactccc aagcaaccgg cagcgccagc gacagctgtc      2400
     agctcaccac caccggcagc ggcacccgcc acgaccagcc ctccggctca gccgtcaatt      2460
     actggagcca tggccgattt atccctcctt caggcgcccc tgcaaccaac acttgcgcag      2520
     cccacgtcta cccctgctcc tgctcaatca ccccccgcta ctcaacctat tcaagcccag      2580
     ccaacggcga ttccagcgcc ccagccgcag cagccaggag cctcacccaa cttttttgca      2640
     caggtggcac aggttgggca acagcaacct atgcaaactg gctttcagca gtcccgacag      2700
     cgcccacagg cacctcaggt catggggcaa aattctctta tcccgcctcc gcctcagcga      2760
     cctctctctg cgcctcagaa catgcctcag caacagcctt ttggcctacc tcagctgcag      2820
     ccacagctga cgggtctacc tcagcaaggc ccccagatcg cagccccagg gcagagtctg      2880
     gccgaaataa accaacagcg cttccagcct tccttccagc cacaacaaac tggattcatg      2940
     gctccgaacc aattccagaa cgggctaatg ccgcaaccta ccggttttca gccccaatcg      3000
     cagtttggga ttcagcagca acagactgga ttcggcctcg caccgcagcc gacaggcttc      3060
     ggaggctttg gtgcccctcc ccagcagccc atgccgactg gcatcaactc tgttcttcct      3120
     cccccgttgc agcctcagcc tacgggtatg aatggttcgg gctctatggc ttactccccg      3180
     tcccctcccc caattcctcc cattccccag cagcagacat tggccccact gcaagcccag      3240
     aagacgggtc cagctcctcc ggtccgcttt ggtgtcaaac ccgatgcacc caagaagctt      3300
     gctcctcagc caacaggtct gaaggccaac ctctcgcaag ccacacccac caacccgttt      3360
     ggcttttag                                                              3369
//

If you have problems or comments...

PBIL Back to PBIL home page