(data stored in ACNUC16935 zone)

EMBL: BN001307.PE294

BN001307.PE294       Location/Qualifiers
FT   CDS_pept        join(808460..808514,808570..808954,809003..809164,
FT                   809213..809365,809444..809566,809649..809868)
FT                   /locus_tag="ANIA_01463"
FT                   /old_locus_tag="AN1463.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008079"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008079"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008079"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDB7"
FT                   /protein_id="CBF84910.1"
FT                   /translation="MQLFAHLLRVATALLLPIGTVAQECSSRENYTARNQTEIDTITQN
FT                   CTTIVGELGLVDWSGPLTLPNITRIRSIRVYSGDITAIELPALTYLGSDLLLTNLPSLR
FT                   RVSLPELQHIEGLYVDLVGNAPELHIPRLTNASSIYLRGNFSDQSFHSLRNVEKKLDIC
FT                   NAVSCGYYSRMNAFTSMRLSFPSLERAGSLIVGGNVSSLSLPELTTLTCNDCDWVALHL
FT                   KLYGSSRLPVNLPKLANTNGSLYIRGDIDSISLPSLREYNRELIMTPYEPLDITLPVER
FT                   AEDFSFTGNVSSLTDFTRIYINSDLDFDCDALWKDLEQTSGPLNESSKEEYFQCSVGVS
FT                   WQPGGSQAATAVAALGLGFVMGLLI"
     atgcagttgt tcgcgcacct gctgcgagtg gcaaccgctc tcctactacc aattggaacc        60
     gtcgcccagg aatgctcaag ccgcgagaac tatacggctc gcaaccagac agagatcgac       120
     acgattaccc aaaactgcac cacaatcgtg ggcgagcttg gtcttgttga ctggtctggg       180
     ccgctaacac tacccaatat cacacgcatc aggagtatcc gagtctactc tggcgacatc       240
     actgccattg agctccctgc tttaacatac ctgggtagtg atctgctcct cacgaacctg       300
     ccttcgctgc gtagagtatc tttgcctgaa ttacagcata tcgaaggact ctacgtagac       360
     ctcgtgggca atgcaccgga gctgcatatt ccaagattga ctaatgcatc gtccatttat       420
     ctacgaggca atttttcaga tcaatcgttt cattccttgc gcaatgttga aaagaaactc       480
     gatatttgta acgccgtcag ctgcggatac tattcccgta tgaacgcatt cacctcaatg       540
     cgtctctcat tcccgtccct tgagcgtgcc ggtagcctca tagttggcgg gaacgtgtca       600
     agcctgtcac tgcctgaact caccaccctt acctgcaatg attgtgactg ggtggcgctg       660
     catctgaagc tctacggctc ctcacgatta ccagtcaacc tccccaagct cgctaataca       720
     aacggatctc tctatatccg aggggatatc gactcaatat cccttccctc cctgcgagaa       780
     tacaaccgcg agctcattat gactccctac gagccgctag atataactct acccgtggag       840
     cgagcagagg atttttcgtt cacgggtaat gtctcgagtt taacggattt cacccgtata       900
     tatattaact cagatcttga tttcgactgc gacgcgctct ggaaggatct cgaacagaca       960
     agcgggccgc tgaatgagag tagcaaggag gagtactttc agtgttcggt gggcgtgtcc      1020
     tggcagccag gaggctcgca ggcggccaca gctgttgctg cgcttggtct tggttttgtt      1080
     atgggactct taatatga                                                    1098
//

If you have problems or comments...

PBIL Back to PBIL home page