(data stored in ACNUC16935 zone)

EMBL: BN001307.PE296

BN001307.PE296       Location/Qualifiers
FT   CDS_pept        complement(join(813061..813690,813743..813860,
FT                   813915..813952,814017..814259))
FT                   /locus_tag="ANIA_10197"
FT                   /old_locus_tag="AN10197.4"
FT                   /product="sulfonate biosynthesis enzyme, putative
FT                   (AFU_orthologue; AFUA_8G04550)"
FT                   /note="transcript_id=CADANIAT00008081"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008081"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008081"
FT                   /db_xref="GOA:C8VMD5"
FT                   /db_xref="InterPro:IPR003830"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036112"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMD5"
FT                   /protein_id="CBF84913.1"
FT                   /translation="MLSPITRATALSSGKAQGSTFQRAAAPMMWSKGFSTTAPGSKKAA
FT                   ILLQDKSNGFGFARSNPRPKKPRSQGVTEIRGPYYTVMGKRYLADILETMGTHVDGLKF
FT                   AGGSFSLFPEKPLRELIDLAHEHSVYVSTGGWAEHLLTHPDPTSVFDKYLTKCEDLGFV
FT                   MLNLVPFRVLTLHHRFDVIELSSGFLSIPEDDWLRLVDKVHSYGLKAKPELGIQFGAGG
FT                   DTSAAGLESLGTSDPGKLVNLGRKFLDAGVERLMIESEGITENVKSWRTDVVSKIMKEL
FT                   PPERVMFEAADPQVYTWYIREFGIDVNLFVDHSQIVQLSGLRHGIWGTADTFGRLVSFR
FT                   AE"
     atgctgtccc ccataactcg agccactgct ctttcgtcgg gaaaggccca ggggtcgact        60
     ttccagaggg ctgctgcacc gatgatgtgg tccaagggct tttcaaccac tgcccctggt       120
     tccaagaaag cagctatcct gcttcaagac aagtctaacg ggtttggatt tgcacggtca       180
     aatcctcgac caaagaagcc gcgatcacag ggagtaactg agattagagg tccttattac       240
     acagttatgg gtaagagata tcttgccgat attctcgaga cgatgggcac acatgtagat       300
     ggactcaaat ttgccggtgg ctctttctct ctcttcccag aaaagccgct gagagaatta       360
     atcgaccttg cacatgaaca cagcgtctat gtctcaacgg gcggatgggc cgagcatctc       420
     ctcactcatc cagacccaac ctcagtcttt gacaagtacc tcaccaaatg cgaagacctt       480
     gggtttgtca tgctcaacct tgttccattc cgggttctga ctttgcacca cagattcgat       540
     gttattgagc tttcgtccgg attcctctcg attcctgaag acgactggct tcgtctggtc       600
     gataaagttc attcgtacgg cctaaaggcg aaacccgagc taggaattca gtttggggcc       660
     ggcggcgata cctcggcggc tggtctcgag tcactcggca cgtccgaccc tggaaaactg       720
     gtgaacctgg gacggaagtt cttggatgcg ggtgtggagc gtctgatgat tgagtcggag       780
     ggtatcacag agaacgtcaa gtcatggagg acggacgtag tgtctaagat catgaaggag       840
     cttccgcctg aacgggttat gtttgaagca gcagatcccc aagtctatac ttggtacatt       900
     cgagagtttg gcatcgacgt caatctgttc gtcgatcata gtcaaattgt tcagctgtct       960
     ggtttgcgcc acggcatttg gggcactgca gatacattcg gacggcttgt gtcttttcgg      1020
     gctgagtga                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page