(data stored in ACNUC16935 zone)

EMBL: BN001307.PE297

BN001307.PE297       Location/Qualifiers
FT   CDS_pept        join(815973..816362,816442..816976,817028..817434)
FT                   /locus_tag="ANIA_01465"
FT                   /old_locus_tag="AN1465.4"
FT                   /product="integral membrane protein (AFU_orthologue;
FT                   AFUA_8G04560)"
FT                   /note="transcript_id=CADANIAT00008082"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008082"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008082"
FT                   /db_xref="GOA:Q5BDB5"
FT                   /db_xref="InterPro:IPR026841"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDB5"
FT                   /protein_id="CBF84915.1"
FT                   /translation="MGAGAILEPLVVIVLLFGGTWINRTAGSFPPSRRARRKSVDRYRG
FT                   VSPDSIESGLCSPTSKDGLLKDRPLSPASSHCGHESWRKRRIGILLWTTEVTSPNTVVF
FT                   QDRLLSRLLRKLPFLAECWYWALVYWTYQLGRAFTAVTLQEGTVDVARKHALKLIEIEQ
FT                   ALGLFWEVPIQQFFLRHPLLMKWTNWIYSFIHIPGTIAFLVWLYYYTITRNHSDEPQSG
FT                   KPRGTASGSPAGPLLYQARRRTLAVCNLLAFVVFTLWPCMPPRLLSDEKVQGPEGKLAR
FT                   SFGFVDTVHGAEGAGSVWTENRFCNQYAAMPSLHFGYSLMIGLTIMTIPLPAHHRVSTR
FT                   VRIGPFGAQIPSRQRLVCLFLGFAYPFMILAAIVATANHFILDAVAGAIVCTLGWKFNS
FT                   VLLNLLPVEDYFLWLVRIHKPEPAEMAGPLDLEEWTDEIEAETA"
     atgggcgccg gagctatttt ggaacctctg gtggtcatcg tcttgctttt cggcggcact        60
     tggatcaacc gtaccgctgg ctcgtttcct ccctcacgtc gtgctcgccg caaatctgtt       120
     gatcgttacc gtggtgtttc accggattcg atcgaatcgg gcctttgttc gcccacgtcc       180
     aaggatggcc tcttgaaaga ccgaccttta tctccagcca gctctcactg cgggcatgag       240
     tcatggcgta agcgaagaat cgggatactc ttatggacca ccgaagttac ctctccgaat       300
     actgttgttt tccaagaccg tcttctcagt cggctgctac gcaagttgcc tttcctggcc       360
     gaatgttggt actgggcgtt ggtgtactgg acataccaat taggaagagc attcacggcc       420
     gtaaccttac aagaaggcac ggtcgatgta gcgagaaaac atgcgcttaa gcttatcgaa       480
     atcgaacagg ccctcgggtt gttctgggag gttccgatcc agcagttctt cctccggcac       540
     ccgttgctca tgaaatggac caattggatc tattcgttta tccatatccc tggaacaatc       600
     gcattcttag tttggctata ttactataca atcacgagaa accattccga tgagccccag       660
     tctggcaagc cccgagggac ggcaagtggc tcacctgctg ggccgcttct ctatcaagcc       720
     cgccgacgaa cattagctgt ttgcaatctc ctcgcatttg ttgtattcac tctatggccc       780
     tgtatgccgc ctcgcctgct aagcgatgag aaagtgcaag ggcccgaggg aaagctggca       840
     cgcagctttg gctttgtgga taccgtgcat ggagccgaag gcgcgggcag cgtgtggact       900
     gagaacaggt tctgcaatca atatgctgct atgccctctc tgcattttgg gtattccctc       960
     atgattggac tcaccatcat gacaatcccg ctgcctgctc atcatcgcgt ctcgactcga      1020
     gttcgaatcg gcccatttgg tgcccagatt ccgtcccgtc aacgcctggt ctgtctattc      1080
     cttggctttg catacccgtt catgattctc gccgccattg tcgctactgc gaatcacttc      1140
     atactcgatg cggtcgctgg tgcgatagta tgtacgctcg gctggaagtt caacagcgtt      1200
     ctgctgaacc tgcttcctgt ggaagactac ttcctttggc tagtccggat acacaagcct      1260
     gagccagcag aaatggcagg accattggat ctcgaagaat ggactgatga aatagaggct      1320
     gagactgcct ga                                                          1332
//

If you have problems or comments...

PBIL Back to PBIL home page