(data stored in ACNUC16935 zone)

EMBL: BN001307.PE298

BN001307.PE298       Location/Qualifiers
FT   CDS_pept        join(819065..819230,819349..819826,819890..820250,
FT                   820300..820522,820572..821209)
FT                   /locus_tag="ANIA_01466"
FT                   /old_locus_tag="AN1466.4"
FT                   /product="PWWP domain protein (AFU_orthologue;
FT                   AFUA_8G04570)"
FT                   /note="transcript_id=CADANIAT00008083"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008083"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008083"
FT                   /db_xref="InterPro:IPR000313"
FT                   /db_xref="InterPro:IPR035441"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDB4"
FT                   /protein_id="CBF84917.1"
FT                   /translation="MAEANTNSPAPAPDSGEAPVERASAELKASPQESASEPTKENTKK
FT                   DANGADGKPAESAPAQDDKKESSDDTADKTEAPAEPAEAKKSDEGAAASADAEPAAAPE
FT                   ANGAPSSTKKASSKRKSTGGDTKSKLNRKKSMSRITHLDAKAGEYYLARLRSFPPWPAV
FT                   ICDEEILPQSLLSSRPVTARRPDGTYREDYADGGKRVAERTFPVMFLQTNEFAWIPNTD
FT                   LSPLDPAACKDISEKGKSKALVAAYNVAAENHDLAYFKNMLADHQAAIQQEEEEREAQE
FT                   AAKAAAKAAKEAKKNKRKSMEVRDDVEMEDADEEKQPKSSKKRKKDAEAEGDDKPAKTP
FT                   KTGTKLKLTTPKNPAEEKKASGSAKAKQSTSKKGKKAAASEDSDESSPAPKEPEPKVNL
FT                   EEAKKKREREVLFIRHRLQKGFISRDHPPKEEEMSQMSGYFTKLEKLNDLEVSIIRETK
FT                   IHKVLRMIIKLPNIPRDEEFDFRKRALDILSKWKNVLDSDRATPSQEKEKEKEEKPKSN
FT                   GVHKEKEGSAEAPVKASESKSEKEDDTKLDTPDQDTPMPDADEKTEEAPAPAKGEDEKV
FT                   ESADAAGETGKSEKKETETDTEKPAEDKAEDKKADEKTAEAETAA"
     atggctgaag ccaataccaa ctccccggcg cctgccccgg attctggtga ggcgcctgtt        60
     gagcgcgctt ctgcggagct caaagctagc ccacaggagt cggcgtcaga gcccaccaag       120
     gagaacacaa agaaggacgc caatggcgcg gatggaaagc ccgctgaaag cgcgcccgct       180
     caagatgata aaaaagaatc ttccgatgac accgctgaca aaactgaggc gcccgcagag       240
     cctgccgagg cgaagaagtc cgacgagggt gctgctgctt cagcagatgc tgagcccgct       300
     gccgcaccgg aagccaacgg agcaccgtca tcgaccaaaa aggcgtcctc taagcgcaag       360
     tctacgggcg gagataccaa atcgaagctc aaccgcaaga agtcgatgag ccgcatcaca       420
     catttggatg ccaaggctgg cgaatactac ctcgcgcgtc ttcgcagctt ccccccctgg       480
     cccgccgtca tctgcgacga ggaaattctt ccgcagagtc ttctaagctc gcgtcccgtc       540
     accgctcggc gacccgatgg aacctataga gaagactacg ccgatggtgg taagcgtgtc       600
     gccgagagaa cattccctgt catgttcctc cagacaaatg agttcgcttg gatacccaac       660
     actgaccttt ctcccctcga ccctgctgct tgcaaagaca tatcagagaa gggtaaatcc       720
     aaggcgcttg tggctgctta caatgtcgcc gcggaaaacc atgatcttgc gtactttaag       780
     aatatgctcg ccgaccacca agccgcaatt cagcaggaag aagaagagag agaagctcag       840
     gaggccgcta aggccgccgc aaaggccgca aaagaagcca aaaagaacaa gagaaagagc       900
     atggaagtcc gcgatgatgt ggaaatggag gatgcagatg aagagaagca gccaaagagc       960
     tccaagaaga ggaagaagga cgctgaggcc gagggcgacg acaagcctgc taagacgccc      1020
     aagactggta ccaaactgaa gctcaccaca ccaaagaacc cggctgaaga gaagaaagcg      1080
     tccggctctg ccaaggcgaa gcagagcacc agcaagaagg ggaagaaggc cgctgcaagt      1140
     gaggacagcg acgagtcgag ccccgcgcct aaagaaccag agcccaaggt caacctagag      1200
     gaggccaaga agaagaggga gagggaagtt ctattcattc gccaccgcct ccagaagggc      1260
     ttcatttctc gtgaccaccc gcccaaggag gaagagatgt cccagatgtc cggctatttc      1320
     accaagctcg agaaattgaa cgatcttgaa gtgtccatca tccgtgagac caagattcac      1380
     aaggtacttc ggatgattat caaacttcca aacatcccgc gcgacgagga attcgacttc      1440
     cgcaagcgcg ctctagacat cctttccaag tggaagaacg tcctcgacag tgaccgtgca      1500
     acaccctctc aggagaagga gaaggagaag gaggagaagc ccaagtccaa cggtgtccac      1560
     aaggaaaagg aaggtagtgc cgaagcgccg gtcaaggctt ctgaatccaa gtccgagaag      1620
     gaggatgaca ccaagctcga caccccggat caggatacac ctatgcctga cgccgatgag      1680
     aagaccgagg aagcaccggc gcctgccaaa ggcgaggatg agaaggtaga gtctgctgat      1740
     gctgcaggtg agacgggaaa gagtgagaag aaggaaacgg agacggacac ggagaaaccg      1800
     gccgaggaca aggccgagga caagaaagca gatgagaaga ctgctgaagc tgaaactgcg      1860
     gcgtaa                                                                 1866
//

If you have problems or comments...

PBIL Back to PBIL home page