(data stored in ACNUC16935 zone)

EMBL: BN001307.PE299

BN001307.PE299       Location/Qualifiers
FT   CDS_pept        complement(822856..824208)
FT                   /locus_tag="ANIA_01467"
FT                   /old_locus_tag="AN1467.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008084"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008084"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008084"
FT                   /db_xref="GOA:Q5BDB3"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR039123"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDB3"
FT                   /protein_id="CBF84919.1"
FT                   /translation="MILSVRPSRACGSAGSSLQAIARENLTGILWSPAARSQSLRRLPQ
FT                   DRPPQPLQRTRLPFLQVHSSRAFHSTPKRDSYTPRISYRVAASSSGKSRRFLPTKNAYN
FT                   FNPELHDALGVAVDTQDPATKRKRRPDSGEDAFFVSTVGRRRDPSKDNTIAFAVADGVG
FT                   GWAESRVDPADFSHALCDYMAQTALDWDGPAEQLRAKYLLQAGYDRVVADETIPAGGST
FT                   ASVGIGLDDGRIELANLGDSGSVLLRQAAVHHYSIPQTHGFNTPYQLSIIPKRMRQQAS
FT                   IFGGGFLEDFPRDANTTTLHMHHGDVLMLATDGVFDNLNNQDILKLVTGRMIYTGAWRA
FT                   STSPNTGIIPADRETLDRLTGAEGVATLVPSAMPKSTSNKSTIVSNPNNHIYTLQSLLA
FT                   ASIAGEAKLASLDPRRDSPFAKEAQRYYPGDHYRGGKVDDIAVLVIIAVEE"
     atgatcttat cggtcaggcc cagtagagcc tgcggttcag ccggcagtag cctacaggcc        60
     atcgcgcgcg agaacttgac agggatcctt tggtctcctg cagcccgatc tcaatctctc       120
     cggcgtctac cgcaggatcg gcctccgcaa ccactacaga gaacacgact ccccttcctt       180
     caagtacatt cgtcaagagc ttttcattcg accccaaaac gtgactcgta tactccgcga       240
     atatcatacc gcgtcgcggc ctcgtcatca ggcaagagcc gccgattcct acccacgaag       300
     aatgcctaca acttcaaccc tgagcttcat gacgccctcg gcgttgccgt cgacacgcag       360
     gaccccgcga ccaaacggaa acggcggccg gatagcggag aggatgcttt cttcgtgagc       420
     acagtaggcc ggcggcgtga tccatccaag gataacacca ttgccttcgc agtggccgac       480
     ggcgtcggcg ggtgggcgga gtcgcgagtc gacccagcag acttttcgca tgccctatgt       540
     gattacatgg ctcagacagc gctggattgg gacgggcccg ctgagcaact ccgcgcaaaa       600
     taccttctcc aagctggcta cgaccgggtt gtcgcagacg agaccatccc cgcaggcggc       660
     agcaccgcgt ctgtaggtat aggcctcgac gacggccgca ttgaacttgc aaacctaggc       720
     gattccggat ctgttctcct ccgtcaggcc gcagttcacc attactcaat cccacagact       780
     catggcttca acactcccta tcaactcagc atcatcccta agcgcatgcg ccaacaagcg       840
     tccatcttcg gcggtggttt tctagaagat tttccacgcg acgcaaacac cacaacactc       900
     catatgcacc atggtgatgt ccttatgctg gccacagacg gcgtctttga taatctcaac       960
     aaccaagaca tcctgaaact cgtcaccggc cgcatgatct acacaggtgc ctggagagct      1020
     tctacatccc ccaacaccgg aatcatcccg gcagaccgtg aaacccttga tcgcctcact      1080
     ggtgcagagg gtgtcgccac ccttgttccc tcagcaatgc caaaatcaac ttcaaataaa      1140
     tccaccattg tctccaatcc caacaaccac atttataccc tgcaatctct tcttgctgcc      1200
     tccattgccg gcgaggcgaa actggcaagc ttggatcccc gccgcgacag ccccttcgcg      1260
     aaagaagcgc aacgctatta ccctggtgat cattaccgcg gcggaaaggt cgacgatatc      1320
     gctgttttgg ttataattgc tgtggaggag tag                                   1353
//

If you have problems or comments...

PBIL Back to PBIL home page