(data stored in ACNUC16935 zone)

EMBL: BN001307.PE3

BN001307.PE3         Location/Qualifiers
FT   CDS_pept        8897..9103
FT                   /locus_tag="ANIA_11673"
FT                   /old_locus_tag="AN11673.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007795"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007795"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007795"
FT                   /db_xref="GOA:C8VKP0"
FT                   /db_xref="UniProtKB/TrEMBL:C8VKP0"
FT                   /protein_id="CBF84375.1"
FT                   /translation="MASDSFLSLKVSDLEILSYENAETWFTKMQAVLDGKEIWYPVQDI
FT                   YLIRQGLDPLPDVDEDDEFFLPP"
     atggcatctg acagcttcct atccctgaag gtctctgatc tggagatcct gtcgtacgag        60
     aatgctgaga cttggtttac caagatgcaa gcagtccttg atgggaagga gatctggtac       120
     ccagttcaag acatctacct gatccgccag ggcttagacc cattacctga tgttgatgaa       180
     gatgatgaat tcttcctacc tccatga                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page