(data stored in ACNUC16935 zone)

EMBL: BN001307.PE301

BN001307.PE301       Location/Qualifiers
FT   CDS_pept        827175..828014
FT                   /locus_tag="ANIA_01469"
FT                   /old_locus_tag="AN1469.4"
FT                   /product="DnaJ domain protein (AFU_orthologue;
FT                   AFUA_8G04610)"
FT                   /note="transcript_id=CADANIAT00008086"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008086"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008086"
FT                   /db_xref="GOA:Q5BDB1"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR004640"
FT                   /db_xref="InterPro:IPR009073"
FT                   /db_xref="InterPro:IPR036386"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDB1"
FT                   /protein_id="CBF84923.1"
FT                   /translation="MATSLRAQRAFQRLTVSSTVQSQARPIHTTTRKLSTPTACFLCRL
FT                   RPSRPNRRTSAIFPSALFAQRTFTSTPSTLNSASSETLPVPNAPDTTNYYTIFPQTLPN
FT                   GPPPSSPFTIDVQALRREFFSLQNTLHPDKYPPGPTKTAAESLSAIINEAYRTLSDPLL
FT                   RAQYLLREFHGIDVTAEDGSGAGAQPLDPELLMEVMDVQEAIEEVGEGQEAVEKIAVMK
FT                   KENDERVKGCVQALAEAFDKGDVEGARGECVRLKFWVSVADGLREWEPGMGGIRLIH"
     atggcgacat ctctccgcgc tcagagagcg tttcaacgac tcacagtctc gtctacagtg        60
     cagtctcaag cacgtccaat ccacacgaca acccgcaagc tatcaacgcc gacagcctgc       120
     ttcctctgtc ggcttcgacc atcgagacct aacaggagaa caagcgccat tttcccgtct       180
     gcattgtttg cgcaacgtac cttcacaagc acgccttcta cgttaaactc ggcatcatcg       240
     gaaacattgc cagtccccaa cgccccagac acaacaaatt actacacaat ctttccgcaa       300
     acgcttccca acggcccgcc cccgtcaagc cccttcacga tcgacgtcca ggccttgcgc       360
     cgggaatttt tctccctaca gaataccctg catcctgaca aatatccacc gggcccaacc       420
     aagacagctg ctgagtcgct ctccgccatc ataaatgaag cgtaccgcac gctttcagac       480
     cctctccttc gcgcccagta cctcctgcgc gagttccatg gtattgacgt cacggcggag       540
     gatggctcgg gggctggtgc gcagccgctg gaccccgagc ttctgatgga ggtcatggat       600
     gtgcaggagg cgattgagga ggttggggaa gggcaagaag cagtggagaa aatcgcggtg       660
     atgaagaagg agaacgatga gcgggtgaag ggatgtgtgc aggcgttggc agaggcattt       720
     gataaagggg atgtggaggg agctagggga gagtgtgtgc gcttaaagtt ttgggttagt       780
     gttgcagatg gattgaggga gtgggagcct gggatgggcg ggattcggtt gattcactga       840
//

If you have problems or comments...

PBIL Back to PBIL home page