(data stored in ACNUC16935 zone)

EMBL: BN001307.PE302

BN001307.PE302       Location/Qualifiers
FT   CDS_pept        join(829465..829473,829671..831071)
FT                   /locus_tag="ANIA_01470"
FT                   /old_locus_tag="AN1470.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008087"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008087"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008087"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDB0"
FT                   /protein_id="CBF84924.1"
FT                   /translation="MEPSGLARHVSKPLDHLINSGKTRESKHQIAILEDEDVETFVAFC
FT                   EYAYTGNYAVPPPGSRENEIEPVSINHALNGAYPDTGSTSPAASWEKSPPKPKVPSEAC
FT                   PGNPDDSNDRDGVGDGDVEPRRDPSQQSSSKDRHVYHSTKSEYTAQNPVATPHDSDNSP
FT                   APWAEDPPTRGRRRRRGKKDQQGVTQDATSKLTPPCTPPGAAQVEPDMPAAEPSEEFPV
FT                   LPGAEQSTSQSPERPGRTLSNGANGSGFGGIRNQREESLTKSRVRPVIDTSFANQQFSP
FT                   RHEKGTTNLWEEFTGIDDSGFRPSFRTRSPNPPAGITLPYLIFHAKLYVFATRYLIPGL
FT                   AHLCLQKLHYDLLNLAFPDPDPENQYEEQLVLTTTKARMIVDLLNYTYTKTTRLEPITP
FT                   SSATQLRDNELRRLVVHYAACKVRDLAVYCPPVEPIAGAAFYPEQPSARGFRALLDTLP
FT                   ELASDLIYRMI"
     atggagccat cgggccttgc ccgccatgtc tccaagcctc tagatcacct catcaatagt        60
     ggcaagacgc gggaatccaa gcatcagatc gccatcttgg aagacgaaga tgttgagacc       120
     tttgtcgcat tctgcgagta tgcgtacacc ggcaactatg ccgtgccacc gcctggatct       180
     cgagaaaacg aaatagagcc agtctctatc aatcatgcgc tcaacggcgc ctacccggac       240
     actggtagca cctcgccggc agcgagctgg gagaagtcgc ctccaaagcc aaaagtccca       300
     agcgaggcat gcccgggtaa tcctgatgac agcaatgata gagatggagt tggtgacggt       360
     gacgtggagc cgcgcagaga tcccagccag cagtcaagtt ccaaagacag gcacgtgtac       420
     cactcgacaa aatctgagta tacagcccag aacccagtcg ctacacctca cgactctgat       480
     aattcgcctg ccccgtgggc ggaagatccc ccaactcgag gtagaagacg ccgcagggga       540
     aagaaagatc agcaaggggt cactcaagac gcgacctcca agctcacccc gccttgcacg       600
     ccccccggcg ccgcacaagt cgagcctgat atgccggctg cagaacctag tgaagagttc       660
     ccggtcttgc ccggtgctga acaatccacc tcacagtcgc cggagcgtcc gggccgaact       720
     cttagcaacg gcgcgaatgg aagtggattt ggaggcatca ggaatcagag ggaggagagt       780
     ttgaccaaaa gccgagtgcg gccagtcata gatacgtctt tcgccaatca gcagttctct       840
     cctcgccacg agaaaggaac aacaaacctg tgggaggagt tcactggcat cgatgacagc       900
     ggttttcgtc cgtccttcag aacaagatcc ccaaacccac ctgctgggat tacattgccc       960
     tatctgatat tccacgctaa gttgtacgtc tttgccacac gctacctgat cccgggtctc      1020
     gcccatctgt gtctgcaaaa actccattac gaccttctaa atctggcgtt tccagaccca      1080
     gaccccgaga atcagtatga ggagcagctc gttctgacca ctaccaaggc tcggatgatc      1140
     gtcgatctcc tcaactacac ctatacgaaa accacccgtt tagagccgat aacgccctcg      1200
     tcggcaaccc agcttcggga taacgagctg cggagactcg ttgtgcatta tgctgcttgc      1260
     aaagtgcgag accttgcagt gtattgtccc ccagtggagc ccattgcagg tgctgcgttc      1320
     tatccagaac aaccatctgc tcgtggcttt cgggctcttc tggatactct tccggagctt      1380
     gcttcggatt tgatataccg catgatatag                                       1410
//

If you have problems or comments...

PBIL Back to PBIL home page