(data stored in ACNUC16935 zone)

EMBL: BN001307.PE303

BN001307.PE303       Location/Qualifiers
FT   CDS_pept        complement(join(832418..832426,832630..832986))
FT                   /locus_tag="ANIA_01471"
FT                   /old_locus_tag="AN1471.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008088"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008088"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008088"
FT                   /db_xref="GOA:Q5BDA9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDA9"
FT                   /protein_id="CBF84926.1"
FT                   /translation="MAPVCSASRLGDYGSVPSSTRQPAKTEIDNASSTGSSTAKLCGTD
FT                   PGAWAVATENETGGKEPSETIGDDWSSGYTLRTEHRARFNSQQPLTNPMRHNAPLIRPI
FT                   DFLGLWPEPDLRTRLVT"
     atggcacccg tttgttcggc ctcccgtctc ggcgactacg gctcagttcc cagttccacc        60
     cggcaaccgg ccaaaacgga gatcgacaac gcatcatcga ccggcagctc cactgccaag       120
     ctttgtggca cggatcctgg cgcctgggca gtggccaccg aaaatgagac gggcggcaaa       180
     gaaccttcgg aaacaatagg ggatgactgg agctccggat ataccctgag gaccgaacac       240
     agagcacgtt tcaactctca acaaccactc accaatccaa tgcggcataa cgctccgtta       300
     ataagaccta tagacttttt gggactttgg cccgagccag acctcagaac ccgtttggtc       360
     acttga                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page