(data stored in ACNUC16935 zone)

EMBL: BN001307.PE304

BN001307.PE304       Location/Qualifiers
FT   CDS_pept        835141..836328
FT                   /locus_tag="ANIA_01472"
FT                   /old_locus_tag="AN1472.4"
FT                   /product="C4-dicarboxylate transporter/malic acid transport
FT                   protein, putative (AFU_orthologue; AFUA_8G04630)"
FT                   /note="transcript_id=CADANIAT00008089"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008089"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008089"
FT                   /db_xref="GOA:Q5BDA8"
FT                   /db_xref="InterPro:IPR004695"
FT                   /db_xref="InterPro:IPR030185"
FT                   /db_xref="InterPro:IPR038665"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDA8"
FT                   /protein_id="CBF84928.1"
FT                   /translation="MFENVPLPQSPRSETSTIVGEEVEMKKGVQMTICERLHHFTWAWF
FT                   TLTMSTGGLALLISNQPFQFQGLREIGLAVYIIDLLFFALCCFLMALRFFLHGGFLKSL
FT                   RHEREGFFFPTFWLSVATIISGLYKFFGEDADESFQLALEVLFWIYCACTLTLAVVQYY
FT                   FVFSSHTYHLQTMMPSWILPIFPVMLSGTIASVIAEQQPARSAIPIVCAGITFQGLGFS
FT                   VAFMMYSHYIGRLMQAGLPHREHRPGMFICVGPPAFTALALVGMTAGLPEQFEILHDES
FT                   SIQDARIMTLIAVSAAVFLWALSLWFFCIAVIAVIRERPTAFHLSWWAMVFPNTGFTLA
FT                   TITLGNWLDSTGIKGVATAMSIGIICMFLFVLVSHVRAVIRQDIMYPGKDEDVSE"
     atgttcgaaa acgtcccctt accccagtct cctcgatccg agacgagtac aatcgtcgga        60
     gaggaggtcg agatgaaaaa gggtgtccaa atgactatct gcgagcggtt acaccacttt       120
     acatgggcat ggttcaccct gaccatgagc acaggaggcc tggccctcct catctctaac       180
     cagccctttc agtttcaggg actcagagaa atcggattgg cagtgtacat catcgacctc       240
     ctcttcttcg ctctctgctg cttccttatg gccctccgct ttttcctcca cggcggtttc       300
     ctcaaatccc tccgacacga aagagagggc ttcttctttc cgaccttctg gctctctgtc       360
     gcgaccatca tctcagggtt gtacaagttc ttcggcgagg atgcagatga gtcctttcag       420
     ctcgccctcg aggtcctctt ctggatctat tgcgcctgca ccctcaccct tgctgtcgtg       480
     caatattatt tcgtcttctc gtctcacacc taccaccttc aaacaatgat gccctcctgg       540
     atccttccaa tcttccccgt catgctttct ggcaccattg cctccgtcat cgctgagcag       600
     cagcccgctc ggtccgcaat ccccattgtc tgcgcaggca ttacattcca gggtctcggc       660
     ttctccgtgg ccttcatgat gtactcgcac tacatcggcc gcctcatgca agccggcctt       720
     ccacaccgcg aacacagacc gggcatgttt atctgcgttg gcccacccgc tttcacagcg       780
     ctagctctcg tcggtatgac cgcaggtctc ccggaacagt tcgaaatcct gcacgacgaa       840
     tcctccatcc aagacgcccg catcatgacc ttgattgccg tctccgccgc cgtcttcctc       900
     tgggcgttga gtctctggtt cttttgcatt gccgttatcg ctgtcattcg tgagcgcccg       960
     actgccttcc acctaagctg gtgggccatg gtctttccta acaccgggtt cacacttgcc      1020
     acaatcacgc tgggcaactg gctcgacagt acaggcatca agggcgtcgc gaccgcaatg      1080
     tcaatcggta tcatctgcat gttcctcttc gtcttggtca gccatgttcg agctgttatc      1140
     cgtcaggaca tcatgtaccc gggcaaagat gaggatgttt ccgaataa                   1188
//

If you have problems or comments...

PBIL Back to PBIL home page