(data stored in ACNUC16935 zone)

EMBL: BN001307.PE305

BN001307.PE305       Location/Qualifiers
FT   CDS_pept        join(838664..838677,838868..838929,839023..839060)
FT                   /locus_tag="ANIA_01473"
FT                   /old_locus_tag="AN1473.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008090"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008090"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008090"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDA7"
FT                   /protein_id="CBF84930.1"
FT                   /translation="MTRDFRTRVGAESRLEVDRPVRVGPGKPVKPSEPPPL"
     atgacgaggg atttcaggac gagagtcgga gccgagtctc gacttgaggt tgatcgccca        60
     gtaagagttg gtccaggaaa gccggtaaaa ccttctgagc ctcctccttt gtag             114
//

If you have problems or comments...

PBIL Back to PBIL home page