(data stored in ACNUC16935 zone)

EMBL: BN001307.PE306

BN001307.PE306       Location/Qualifiers
FT   CDS_pept        complement(839525..840736)
FT                   /locus_tag="ANIA_01474"
FT                   /old_locus_tag="AN1474.4"
FT                   /product="RNA-3'-phosphate cyclase family protein
FT                   (AFU_orthologue; AFUA_8G04640)"
FT                   /note="transcript_id=CADANIAT00008091"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008091"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008091"
FT                   /db_xref="GOA:Q5BDA6"
FT                   /db_xref="InterPro:IPR000228"
FT                   /db_xref="InterPro:IPR013791"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR016443"
FT                   /db_xref="InterPro:IPR023797"
FT                   /db_xref="InterPro:IPR036553"
FT                   /db_xref="InterPro:IPR037136"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDA6"
FT                   /protein_id="CBF84932.1"
FT                   /translation="MATTSQPPIKLTGHKNFVYRLVFSTLTGRTIHISQIRPSSPTNPG
FT                   LASHEISFLRLLEAVTNGSQMEISYTGTIIVYKPGLITGTASGVGASSGSVIRHEIPAG
FT                   CTRGVSYFLIPLCLLAPFSKAPIKVLFTGPGVITSSTPTGDMSVDSVRTAILPLFNQFG
FT                   IFNNIELRVLRRSNLGPNGRGGGGEVQLVFGHQVRLPKTLHLMNAGRIKRVRGVAYSVG
FT                   VSASNNARMIDTCRGVLNPLVPDTYIFSDVSSAPLVPAPERNNPSAKKKIGLGFGLSLV
FT                   AESSTGCLFSADVACPPSGGQPPEDIGKQCAYQLLETISKGGCVAPAAFPIMIGLMTMG
FT                   SEDVGRIQVGRDIIGDESSIQLARDLMKFGAPGWGLRDAGDESNDVIISVVGRGIGNVG
FT                   RKVA"
     atggcgacca cctcgcaacc gcctatcaag cttaccggcc acaagaactt tgtctatcgc        60
     ctcgtgttct ctaccctgac cggccgcaca atccacatct cgcagattcg tccttcctct       120
     cctaccaacc caggtcttgc atcgcacgaa atctcattcc ttcgattact agaggctgtt       180
     acaaatggct cacaaatgga gatctcgtac actggtacaa tcattgtcta caaaccaggc       240
     ctaattacag gaactgcttc tggcgttgga gcaagcagcg gtagtgtaat taggcacgag       300
     attccagcag gatgtactcg cggtgtcagc tacttcctta tcccattatg cctactggcc       360
     cctttctcca aagctccaat caaagtcctt ttcaccggtc ccggtgtaat tacttcctca       420
     acaccaaccg gggacatgtc cgtggacagc gttcgaaccg cgatcctgcc gctcttcaac       480
     cagttcggta tcttcaacaa catagagttg cgtgtgctcc ggagatcaaa ccttgggcct       540
     aacggaagag gcggtggtgg agaggtccaa ttggtcttcg gccatcaagt tcggctcccc       600
     aagactctgc acttaatgaa cgctgggagg atcaagaggg tacgcggagt agcatactct       660
     gttggcgtct ctgcttcgaa caatgccagg atgattgaca cttgccgcgg tgtcctcaac       720
     ccgcttgtcc cggacactta tatcttctcg gacgtgtcgt cagctccact cgttcccgcc       780
     ccggaaagga acaacccctc cgctaagaag aagatcggcc ttgggtttgg cttgtctctt       840
     gttgccgaat cttcgaccgg ctgcctgttc tcagctgacg tggcgtgccc gcccagtggt       900
     ggtcagccgc ctgaggatat tgggaagcag tgcgcatacc agctacttga gacgatctca       960
     aagggcggat gtgttgcccc tgcagctttc cccattatga ttggattgat gaccatggga      1020
     tccgaggacg taggccgtat ccaggtcggt cgtgatatta ttggggatga gagctcaatc      1080
     cagctggcaa gggacttgat gaagtttggt gccccaggtt ggggtctgag agacgctggg      1140
     gatgaaagta acgatgtcat catcagcgtt gtcggacgcg gtattggcaa tgtgggacga      1200
     aaggtcgctt ga                                                          1212
//

If you have problems or comments...

PBIL Back to PBIL home page