(data stored in ACNUC16935 zone)

EMBL: BN001307.PE309

BN001307.PE309       Location/Qualifiers
FT   CDS_pept        join(845543..845662,845716..846325,846372..846901)
FT                   /locus_tag="ANIA_10193"
FT                   /old_locus_tag="AN10193.4"
FT                   /product="serine/threonine protein kinase, putative
FT                   (AFU_orthologue; AFUA_8G04670)"
FT                   /note="transcript_id=CADANIAT00008094"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008094"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008094"
FT                   /db_xref="GOA:C8VME8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C8VME8"
FT                   /protein_id="CBF84937.1"
FT                   /translation="MAQYFFDLLYNFTDCMCCFPSSPQLKINNRSFKLLRLLGEGGFSY
FT                   VYLVQDKSTSELFALKKIRCPFGQESVSQALKEVEAYSLFTSEKNIIHSIDHCVSTESG
FT                   SKFRSDGGEAGSKTVYILLPYYQRGNLQDAINANLVNQTRFPEKRLMVLMLGVAQALRA
FT                   MHQYRVKSGSGPTRKAKAVRKEGAEADVEMRKGKGKRRGSQPAGEEDSENEPLMDDEVT
FT                   QSQEGYEDGNLRPYAHRDIKPGNIMIDDDGQSPILMDLGSLAPSPIAITSRSLALAVQD
FT                   TAAEHSTMPYRAPELFDVKTGSIIDTKVDIWSLGCTLYACLVGKSPFEARSEETGGSLS
FT                   MCVLGGDWRFPDEKSGATKGKGKASEQQKQDSAASISSPVKEVVRRCLQVEPADRPDID
FT                   ELIQMLKEVIRELPDDDVVG"
     atggctcaat acttcttcga tctcctgtac aattttacag attgcatgtg ctgcttcccc        60
     agctcgccgc aactgaagat caacaaccgc agcttcaaac tgctgcggct cctcggcgag       120
     ggaggctttt cctacgtgta cctcgtccaa gacaagtcca catccgagtt attcgcactc       180
     aagaagatcc gatgcccgtt cggccaggaa tccgtgtcgc aggccctcaa ggaggtagag       240
     gcttacagcc tatttacgtc ggagaagaat atcattcatt caatcgacca ctgcgtctca       300
     acagagtctg gatccaagtt tcgcagtgat ggcggagagg ccggttccaa gacggtctac       360
     attctgctgc cctactacca acgagggaac ctacaggacg cgattaacgc aaaccttgtg       420
     aaccagacgc gattccccga gaagcgtctc atggttctta tgcttggagt cgcccaggca       480
     ttgcgcgcga tgcaccagta ccgcgtcaag agcgggtctg ggcccacgcg caaggccaag       540
     gctgtgagga aagagggcgc agaggccgat gtagagatgc ggaaggggaa gggaaagcgg       600
     cggggtagtc agcctgctgg ggaagaggac tctgaaaatg agccgctgat ggatgacgag       660
     gtcactcaga gccaggaagg atatgaagat ggaaacctgc gcccctacgc gcaccgagat       720
     atcaagcctg gaaatatcat gatagatgac gacggacaaa gtccgatcct gatggatctt       780
     gggtcgctgg cgcccagtcc aatcgccatc acctctcgct cactcgcgct agcggttcaa       840
     gatactgcgg cggagcacag tacaatgccg taccgagcgc cagaactctt cgacgtcaag       900
     acaggatcga tcatcgacac taaagtggat atttggtctt tgggatgcac actctacgcc       960
     tgcttagtgg ggaagagccc gttcgaagct cgaagtgaag agacaggggg tagtctgagt      1020
     atgtgcgtac tcggcggaga ctggaggttt cccgatgaaa aatctggagc gaccaagggc      1080
     aaaggcaagg ctagtgagca gcaaaagcag gatagtgccg cttctatcag ctctcccgtc      1140
     aaggaggtcg tgcgtcggtg cttgcaggtc gagcccgccg accgtcccga tattgacgag      1200
     ttgattcaaa tgcttaaaga ggttatcagg gagctgccgg atgacgacgt ggtgggttga      1260
//

If you have problems or comments...

PBIL Back to PBIL home page