(data stored in ACNUC16935 zone)

EMBL: BN001307.PE31

BN001307.PE31        Location/Qualifiers
FT   CDS_pept        join(87193..87466,87519..88132)
FT                   /locus_tag="ANIA_09031"
FT                   /old_locus_tag="AN9031.4"
FT                   /product="fumarylacetoacetate hydrolase family protein
FT                   (AFU_orthologue; AFUA_4G01490)"
FT                   /note="transcript_id=CADANIAT00007822"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007822"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007822"
FT                   /db_xref="GOA:Q5ARP9"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARP9"
FT                   /protein_id="CBF84427.1"
FT                   /translation="MCPIEICWTHLVRYSSTANGPIKYGEPILGQTGDIGKLARDDQLK
FT                   VKRLLGSDPFLLEKTDVVETVYRLYGPLEPKDVPIIRCIGLNYKTHILETGRPLPTCPT
FT                   VFTKPSPAVADHDAPVPIPKIAQEQCDYEGELVIVIGREGKNIPEAEALNYVAAYTAGN
FT                   DISARDWQREAGKAGPVPQWTFSKSFDNYAPLGPCLVRQDQLNEASMLSLRTLVNGDVR
FT                   QESHTSDLCFGVRKLVAFCSQGQTLQRGSLIMTGTPGGVGLFMKPPQFLKDGDVVSVEI
FT                   ESIGTLQNTISFEN"
     atgtgtccca tcgagatttg ctggactcat cttgtccgct atagctcgac cgccaatggc        60
     cccatcaagt atggagagcc cattctcggc caaactggcg atattggcaa actggccaga       120
     gatgatcaac tgaaagtgaa gcgacttttg ggcagtgatc catttcttct ggagaagact       180
     gatgtcgttg agactgtcta tcgtctctac ggtcccctcg aaccaaagga tgtgcctata       240
     atccgctgca tcggcctcaa ctataaaaca cacattcttg aaaccggaag gccgctacct       300
     acttgtccta ccgtcttcac caagccgagc ccagcagtag ccgatcatga cgctccggtt       360
     cctattccaa aaattgcaca ggagcaatgc gattacgagg gtgaactcgt cattgtcatt       420
     ggccgtgaag gcaagaatat tccagaagcc gaagctttga actacgttgc tgcttacact       480
     gctggcaatg acatttccgc ccgggactgg caacgcgagg ctggaaaggc cggtcctgtt       540
     ccccaatgga ctttcagcaa gtcttttgat aactatgctc ccctgggacc ctgcctcgtc       600
     cgacaggatc agcttaatga agcgagtatg ctgtctctac ggaccttggt caacggagat       660
     gttcgtcagg aaagccacac gtcggatttg tgcttcggcg ttcggaagct tgttgcattc       720
     tgtagccaag gtcaaaccct acagagagga tctttgatca tgactggaac tccgggtgga       780
     gttgggcttt tcatgaagcc acctcagttt ctgaaggatg gtgatgtggt gagcgtggag       840
     atagagtcta tcggcaccct gcaaaacacc atttcctttg aaaattag                    888
//

If you have problems or comments...

PBIL Back to PBIL home page