(data stored in ACNUC16935 zone)

EMBL: BN001307.PE312

BN001307.PE312       Location/Qualifiers
FT   CDS_pept        complement(853194..854396)
FT                   /locus_tag="ANIA_10199"
FT                   /old_locus_tag="AN10199.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008097"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008097"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008097"
FT                   /db_xref="GOA:C8VMF1"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMF1"
FT                   /protein_id="CBF84943.1"
FT                   /translation="MDNHKKDKFSHCPESHPIPPRTPTLSPSRDEPNGLPLPDHIDEML
FT                   ENAQQSPIESEIMGERLHRAEQIEIEQQEGQPKLEPQSWCPPSSAGESRELPTAAAAID
FT                   HMIEHPRNSRCEAEEIRKLLQGRGEITRLAQQAKRIVSNTRNRWLAIGQHIHRDPKHQD
FT                   TLSEGLNRLEAVRQGIEDCTRRIEARLRQYHTQERQQRLRRRLQRRQQRRQVQQITSYL
FT                   QQSGFDLGLELSYDGPSQSASNSVLEFHPEFQNKIAHLARKLHPLVSYSTGLIHPYFPK
FT                   SVLAFNLLTSAQLDALALHFHQVYPPRRETFLYPLPIKPWLATNGFLRDLGVDTEVKRR
FT                   RFGRFIGLKGCESPVKTRSDEGSVVEQVERDWERRYRNALAVQMRNVEESYMFMDGLDN
FT                   V"
     atggataacc acaagaagga caagtttagc cactgtccgg aatcacaccc aataccgccc        60
     cggaccccaa cgttgtcccc gtctcgagac gagccgaacg gattgcctct acctgaccat       120
     atagatgaga tgcttgagaa cgcccagcag tcaccgatcg agtcggagat catgggagaa       180
     agactgcacc gagcggagca aatcgaaata gaacaacagg aagggcagcc caaattagaa       240
     ccccaaagct ggtgcccacc tagttctgca ggggaatcaa gggaattgcc tactgcagcc       300
     gcggccatag accatatgat cgaacatccc agaaattccc ggtgcgaagc tgaagaaatc       360
     cgaaaattat tgcaaggacg tggcgagatt acacgactag cacaacaggc gaagcggatt       420
     gtatccaaca cccgaaaccg gtggctggct atcggccagc acatccacag agacccaaaa       480
     caccaggata cgttatcaga aggcctcaac cgcctcgaag cagtcagaca gggaattgaa       540
     gattgcacac ggcgtattga ggcacggctg cgccagtacc atacgcaaga acgccagcaa       600
     cggctccgcc gccgcctcca gcgccgacag caaaggcgcc aggtgcaaca aatcacgtcc       660
     tatctgcagc aatccggatt tgatcttgga cttgaactta gctatgacgg accgagtcaa       720
     tcagcttcaa actcagtctt agaatttcac cccgaatttc aaaacaaaat cgcccacctc       780
     gcgcgcaagc tccacccgct tgtctcgtac tcaacgggcc tcatacaccc atactttccc       840
     aaatcagttc tcgctttcaa ccttttgaca tcagcgcagc tcgatgcact agcacttcac       900
     tttcaccaag tgtatccgcc gaggcgcgag accttcctgt atccacttcc tatcaagccg       960
     tggcttgcaa ccaatggctt cctgcgggat ctgggcgtag atacagaagt taaaaggaga      1020
     cggtttggaa gattcatcgg gctaaagggc tgtgagagtc cggtcaagac gcggagcgat      1080
     gaggggagtg tggttgagca ggttgagagg gattgggaaa ggaggtatag gaatgcattg      1140
     gcagtgcaga tgaggaacgt ggaggagagt tatatgttca tggatgggtt ggataatgtt      1200
     tga                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page