(data stored in ACNUC16935 zone)

EMBL: BN001307.PE313

BN001307.PE313       Location/Qualifiers
FT   CDS_pept        complement(join(854816..856973,857037..857068))
FT                   /locus_tag="ANIA_10198"
FT                   /old_locus_tag="AN10198.4"
FT                   /product="oligopeptidase family protein (AFU_orthologue;
FT                   AFUA_8G04730)"
FT                   /note="transcript_id=CADANIAT00008098"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008098"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008098"
FT                   /db_xref="GOA:C8VMF2"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMF2"
FT                   /protein_id="CBF84945.1"
FT                   /translation="MTIRSMKFTPEVLLGAPRRSGAVPNSTGTLAVYTQTTYSFESHSK
FT                   TNEIRVLDLKTGRSALITNDPGASSPQWIDNTDQLIWLKSKGNGNTSLIIGDARQADRT
FT                   YTAGTVPGPVSDLKVTVIESGKIGFAVAGKSNPDGTLYNPQDAKAPHSTGKLYTSLFVR
FT                   HWDSYIEPQRNAIFFGLLQRAPLSPATRQAGKYSVSGITNLIAVCGLTGVESPIPPFGG
FT                   GGDFAVSPSAIVFVARDPDVNPALHTACSCYYCPMFSWTGVSAVESRICRVQGLEGAMS
FT                   SPVLSSDGSSIAVLAMRQDGYESDKNRILYVPNPWSGEMIEAFASANGKGLWNLSPSGL
FT                   TFSNDDNYLYIQAEEYGRGVLFRLPVANIRHSTPNMLKKITSSGYVTDVHPVTSKSSHL
FT                   LISSNSLVDNSIWTVVDPANPADAHVISSIGHGGAAFGLSAAQVDEIWYRGAEDTPIHA
FT                   WVVKPSNFRPGSKYPLAFLVHGGPQGAWNDQWSTRWNPAVFAEQGYVVITPNPRGSTGY
FT                   GQEFTDAIRGSWGGLPYIDLEKGFDYIEKNLKYVDTNRAVALGASYGGYMMNWIQGQPL
FT                   GRRFRALVTHDGVFSTTSLLATEELYFPLHDLKGVQWIVPENWAQWDPSRHLDKWQTPH
FT                   LIIHNEKDYRLTIAEGLSAFNVLQMKGIDSAFLTFPDENHWVLNPENALMWHYTIFNWI
FT                   NKHVGLPAASERFEQFSGNEKVALQNRLAKVSLSN"
     atgaccatcc gatccatgaa atttacgcca gaggtacttc tcggagcacc tcgacggtcc        60
     ggggccgtgc ctaattcgac tggaacgctc gccgtttata cccagacaac atattcgttc       120
     gaatcccatt ccaagacgaa tgagattcgt gtgttggacc ttaagaccgg tcgatctgcg       180
     cttatcacaa atgatcctgg cgccagctct ccgcaatgga ttgacaatac tgaccagctg       240
     atttggttaa agtcaaaggg gaatggaaac acaagtttga tcatcggaga tgctcgacag       300
     gcggatcgga cctatactgc gggcacagta cctggtccag tgtcagacct taaagtcact       360
     gttatcgagt caggcaaaat tggcttcgct gtagctggca aatccaaccc tgacggaacc       420
     ctatacaatc ctcaggacgc caaggcgcct cacagcaccg gcaagctata tacctcgctc       480
     tttgtgaggc attgggattc gtacattgag cctcagagga atgctatctt ctttggcttg       540
     ctccagcgtg ctcctctgtc gcccgctact cgacaggcgg gaaagtattc cgtttcaggg       600
     attacgaatt tgatcgctgt ctgtgggctt accggtgttg agtcgccaat cccaccattt       660
     ggaggaggag gcgattttgc ggtcagtcct tcggcgattg tgtttgtggc gcgagatcct       720
     gatgttaatc ccgctttgca tacggcatgc tcgtgctatt actgtcctat gttttcgtgg       780
     accggcgtga gcgctgttga gagcaggata tgtcgagttc agggtctgga aggtgccatg       840
     tcatcccccg tgctttcgtc tgacggtagc tccattgctg ttttggcgat gcgccaggac       900
     gggtatgagt cggataaaaa ccggattctc tacgttccta atccttggag tggcgagatg       960
     attgaagcat ttgcatcggc aaatggcaaa gggctctgga atctcagtcc ttcagggctg      1020
     acattctcca acgatgacaa ttatctttac atccaggcgg aggagtacgg acgtggggtg      1080
     ctttttcggc tccctgtcgc caacattcgt cactcgacgc caaatatgct caaaaaaatc      1140
     acaagttccg gctatgtgac agacgtccac cctgtcacat ctaaatcctc ccacctacta      1200
     atctccagta acagcttagt agacaacagc atatggactg tggttgaccc cgcgaaccct      1260
     gctgatgccc atgtcatctc ttccattggc catggcggag ctgcttttgg tctttcggca      1320
     gctcaggtgg acgaaatttg gtacagaggg gcagaagaca ccccgatcca cgcgtgggtg      1380
     gtgaagccgt ccaactttag accaggttcc aagtaccctc tggcatttct ggttcatggc      1440
     ggcccgcaag gcgcatggaa tgatcaatgg agtacgaggt ggaaccctgc ggtttttgct      1500
     gagcaaggat atgttgtcat aacgccgaac ccgcgaggca gcaccggtta tgggcaggaa      1560
     ttcactgatg caattcgcgg gtcctggggc gggttaccct atattgatct cgagaagggc      1620
     ttcgactata tcgagaaaaa cctgaagtac gtcgacacga accgcgctgt ggctctgggc      1680
     gcatcctacg gtggctacat gatgaactgg attcaaggcc aaccgctcgg acgacgattc      1740
     agagctcttg tgacgcacga tggcgttttc agcacgacct ccctgcttgc caccgaagag      1800
     ctgtattttc ctttgcacga tcttaagggc gtgcagtgga tagttcctga gaactgggca      1860
     caatgggatc cttctcgtca cctggataag tggcagacgc cacacctcat catccacaat      1920
     gagaaggatt atcggctgac gatagccgaa ggcctctcgg cgtttaacgt gctgcagatg      1980
     aagggtattg acagcgcttt cttgacattc ccagacgaga atcactgggt ccttaacccg      2040
     gaaaatgcac tgatgtggca ttatactatt ttcaactgga tcaacaagca tgtcggtctc      2100
     cctgccgcct ccgagcgctt cgagcagttt tcaggtaatg aaaaggtggc gctccagaac      2160
     cgtctggcga aagtcagcct ttcaaattga                                       2190
//

If you have problems or comments...

PBIL Back to PBIL home page