(data stored in ACNUC16935 zone)

EMBL: BN001307.PE315

BN001307.PE315       Location/Qualifiers
FT   CDS_pept        join(864548..864907,864952..865741,865955..867579)
FT                   /locus_tag="ANIA_01479"
FT                   /old_locus_tag="AN1479.4"
FT                   /product="DNA-binding protein of the mitochondria
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00008100"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008100"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008100"
FT                   /db_xref="GOA:Q5BDA1"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDA1"
FT                   /protein_id="CBF84949.1"
FT                   /translation="MPVNGSRLPYLVQSQARSLARPNTILPYRCLVHRTICHHAQPRRV
FT                   AAPQLTTVFHNQRRSAKTKSTVKLKDLPQGAVKLEPYQDVVEDTPRYPTVVQGHRNNMQ
FT                   KFKNCVVLTRVGGFYELYFEQAEELAPLLNLKLATKKTSAGPVPMAGFPFFQLDRFLKI
FT                   LVQDLNKFVAISEEFAISAEEKARSGMLFDRKVARVITPGTLIDEKFMDPSENNFLMAI
FT                   YLNPSDLGMHARGSDESSYQHILTSASQNVGLAWLDLSTGDFYTQSTTAQMLPSAIARI
FT                   GAREILVDQRLQDLAGQELQLLIGHEHRLMTCFSFPEKISPVSDWASMLEAPLPSTSID
FT                   AFSQEEVAAGYSLLEYIRVQLQGLNLKLQPPRRRHLNESMSIDLQLLKRSYDAQRLVQK
FT                   FTLGKGDADDLICLSKSIEASKNVKRLLSAASNASSEYSRKSLQKMVDQLYLDGPTLLA
FT                   DKILSAIDEEGLLQKQRIEEDTAAEAAILAQEVTLNEGAAADLASLPKKVREKTTERTA
FT                   TDESSPDETWIMRRDASPALKELHRTLDELQNEKSKLGQYLRDSVGSSAITLKWTPGLG
FT                   HICHVKGAKVSQQQLEDIGVTRNVSSTKSTRSFYLPAWTELGGRMDQIKVQIRQEEQAI
FT                   FEQLRREVILNLVKIRRNASVMDELDVACSFATLAAEQQLVRPILTEGTNYKIIGGRHP
FT                   TVKLGLEEQGRRFVSNDCFLGESERIWLITGPNMAGKSTFLRQNALITILAQVGSFVPA
FT                   DYAEIGIVDQIFSRIGAADDLFRDQSTFMVEMLETAAILKQATARSFVIMDEVGRGTTP
FT                   EDGTAVSFACLHHLHYRNQCRTLFATHFHGLADMTQEFPALGRYCTDVKETTEGRFSFV
FT                   HKLRKGINRESHALKVAQLAGLPSETLELARSVRDSIRGEASRLTTAAFSSAS"
     atgccagtta atgggtctcg cttaccttac ttagttcagt cgcaggctcg atctctggct        60
     cgtccaaata ctatccttcc ctatcgctgc cttgtgcaca ggacgatatg ccatcatgct       120
     caaccgcgac gcgtcgcagc tccgcagctc accacggtct tccacaacca gcgacggtca       180
     gctaaaacaa agtccacggt aaaactcaag gaccttcctc aaggcgcggt aaaattggag       240
     ccatatcaag atgttgtgga ggatacgccc cgatatccaa cggttgttca gggacaccgc       300
     aataacatgc aaaagttcaa gaactgtgtt gtcctaacta gggttggagg cttttacgag       360
     ctctattttg aacaagccga ggaacttgcc ccgttactca atttaaagct tgcgaccaaa       420
     aaaaccagtg ccggtcctgt tcctatggcc ggcttcccat tcttccagct agatcgcttc       480
     ctcaagattc tcgtccagga tctgaataaa tttgttgcga ttagtgaaga atttgccatt       540
     agcgcagagg agaaagctcg gtccggtatg ctttttgaca gaaaagtagc gcgggtcatc       600
     acgccaggca ccctgatcga tgagaagttc atggatccgt ctgaaaacaa cttcctaatg       660
     gcaatctatc tcaacccgtc agatctgggg atgcacgcca gaggcagcga cgaatcctct       720
     tatcagcata tacttacgtc cgcctcgcag aatgtcggct tggcctggct ggacctctcc       780
     acgggcgatt tctacactca atctactaca gcacagatgc ttccatctgc aatcgcaagg       840
     ataggtgctc gagaaatcct cgtagaccaa cgtcttcagg atctggccgg acaagagctg       900
     cagctgctta tcggccacga acatcggctg atgacatgtt tcagtttccc tgaaaagatt       960
     tcgccagttt cagactgggc gtctatgctg gaagcacctc ttccatccac atcgatcgac      1020
     gccttcagcc aggaggaagt tgcggcgggc tacagtctgc tagaatacat ccgggtccag      1080
     ttgcagggtc ttaatctaaa gctgcaaccc cctcgccgcc gacatctaaa cgaatctatg      1140
     agcattgacc tacagctgtt gaaacgcagt tacgatgccc aacgtttggt tcagaaattt      1200
     actcttggga agggagatgc agatgatttg atctgccttt caaagtctat agaagcctca      1260
     aagaatgtca agcggctatt atcggccgcg agtaacgcaa gctcagagta ttctcggaaa      1320
     tcacttcaga aaatggttga tcaactctat ctagatgggc caacgctatt ggctgacaag      1380
     atcctgtccg caattgacga agaagggcta ttgcagaagc agcgtatcga ggaagacact      1440
     gcagctgaag ccgctattct agcccaagag gttaccctca atgaaggcgc agcggctgat      1500
     cttgccagtt tgccaaagaa agtccgggaa aagaccactg agcgcacagc aaccgacgaa      1560
     tcctcccctg acgagacgtg gattatgcga cgagatgcaa gtcctgcgct gaaagaactc      1620
     caccggacac tagatgagct gcagaatgaa aaatcgaaac tcggccagta tcttcgtgac      1680
     tccgtcggat cctccgccat cacgctcaaa tggacgcctg gtttgggaca catatgccat      1740
     gtcaaaggcg caaaagtttc ccaacagcag ttagaagaca taggcgtgac gcgcaacgtc      1800
     tcgtcaacaa agtcaacccg gtccttctac ctcccggctt ggaccgaact cggcggccga      1860
     atggatcaaa taaaggtcca aattcggcag gaggagcaag ccatcttcga gcagttacgc      1920
     cgcgaagtta tcttgaacct ggtaaagatt cgccgcaacg cctcagtcat ggacgaactc      1980
     gatgtcgctt gctcatttgc caccctcgca gccgaacaac aactcgtgcg tcccatcctc      2040
     actgaaggca caaactacaa gatcatcggc ggccgccatc caaccgtgaa actcggcctt      2100
     gaagaacaag gccgccgctt cgtcagcaat gactgcttct tgggcgaatc cgagcgcatc      2160
     tggcttatca caggccccaa catggccggg aaaagcacat ttctgcgcca aaacgcgctt      2220
     atcaccatcc tggcgcaagt gggctccttt gtgccagctg actacgctga gatcggcatt      2280
     gtcgatcaga ttttcagtcg tatcggcgca gcagacgatc tctttcgcga tcagtcaacg      2340
     tttatggtcg agatgctgga gacagctgcg atcctcaaac aagcgacggc aaggtcattt      2400
     gtgatcatgg atgaggttgg acgtgggacg acgccggagg atggcaccgc ggttagtttc      2460
     gcatgcctgc atcatttgca ttatcggaat caatgccgga cactgtttgc gacgcatttc      2520
     cacggactgg ctgatatgac gcaagagttt cctgcgctgg gaaggtattg caccgacgtt      2580
     aaggagacga ctgaggggcg gttttctttt gtccacaagt tgcggaaggg cataaatcgg      2640
     gagtcacatg ctctgaaagt tgcgcagctg gcgggattgc ctagcgagac gctggagctg      2700
     gcgcgaagcg ttcgtgatag tatccgcggc gaagcctctc gactgacaac ggccgccttt      2760
     tcttctgcgt cataa                                                       2775
//

If you have problems or comments...

PBIL Back to PBIL home page