(data stored in ACNUC16935 zone)

EMBL: BN001307.PE319

BN001307.PE319       Location/Qualifiers
FT   CDS_pept        complement(join(875188..875231,875300..875510,
FT                   875567..875780,875882..875908,875973..876088,
FT                   876140..876154))
FT                   /locus_tag="ANIA_01483"
FT                   /old_locus_tag="AN1483.4"
FT                   /product="peroxisomal membrane protein (PmpP24), putative
FT                   (AFU_orthologue; AFUA_8G04780)"
FT                   /note="transcript_id=CADANIAT00008104"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008104"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008104"
FT                   /db_xref="InterPro:IPR019531"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD97"
FT                   /protein_id="CBF84956.1"
FT                   /translation="MDALVSRLDALVTNADLAPLLSLVKGIRNGAVYGAKVRFPHALVM
FT                   IFLFRSGTIREKVKLVLNATRQHARNLAVFCFIYKSSMIVLRNLNPAGVGKEGHYDSFL
FT                   AGLLGGYAVFGRHKSSITQQIVIYIFARVVLGFAKLSVQPGMHPLSSLIGPEARKQIES
FT                   NAWAVFASLSWASVMYLFRWHPEVLMSSLRSNIPTQITGTRSATS"
     atggacgctt tggtttctcg tctggatgct ctcgttacaa atgcggatct tgcaccgctc        60
     ctgtcacttg taaagggtat tcgcaatggc gcagtatacg gcgccaaggt gcggtttccg       120
     catgctctgg tgatgatttt tctttttcga tccggaacta ttcgcgagaa agtcaagctc       180
     gttctcaacg cgacccgcca acatgcccgt aacctcgccg tcttttgctt tatatacaag       240
     agctctatga ttgtcttgcg caatctcaac cccgctggtg tcgggaagga ggggcattac       300
     gatagtttcc ttgcaggact gctgggaggc tacgcggttt tcggccggca caagtccagc       360
     atcacgcaac agatcgtgat ttatatcttt gcccgcgtag tccttggctt cgccaaactc       420
     tccgttcagc ccgggatgca cccactatca tctcttatcg gccctgaagc acgaaaacag       480
     atcgagagca acgcctgggc tgtctttgcg tcgctgagct gggcatctgt catgtatctc       540
     ttccgctggc atcccgaagt cttaatgtct agtttgcgga gtaatattcc gactcagatc       600
     actgggactc gttccgcaac ttcctag                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page