(data stored in ACNUC16935 zone)

EMBL: BN001307.PE320

BN001307.PE320       Location/Qualifiers
FT   CDS_pept        complement(join(876531..877512,877621..877634))
FT                   /locus_tag="ANIA_10200"
FT                   /old_locus_tag="AN10200.4"
FT                   /product="ribosome biogenesis protein, putative
FT                   (AFU_orthologue; AFUA_8G04790)"
FT                   /note="transcript_id=CADANIAT00008105"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008105"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008105"
FT                   /db_xref="GOA:C8VMF9"
FT                   /db_xref="InterPro:IPR007109"
FT                   /db_xref="InterPro:IPR039770"
FT                   /db_xref="PDB:4XD9"
FT                   /db_xref="PDB:5BY8"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMF9"
FT                   /protein_id="CBF84958.1"
FT                   /translation="MLREVKPKNPRTARILKAKEPQLIEGAKRVLLLHGSKCPTPLHTV
FT                   LKVFHSLTTPHSVLFHKKNENIHPFESTESLEFLANKNDCGMVIFGSSNKKRPNCLTIA
FT                   RIFDSKVLDMAELLLLPDANGEGIPEMNRLSMHVAIGLRPLMLFSGSAWDDTTSTTHTM
FT                   LKSMLVDLFKGETSDKIDVEGLQYALMVGAEEPTAGLAPIIHLRWYKIVTKRSGHKLPR
FT                   VELEEIGPKLDFKVGRIQEAPRDVMKEAMKQGKKPNEEIKNKKNIGIDLIGDKVGRVHL
FT                   AKQDLGGLQTRKMKGLKRRAGVESDDEGDADMMDVDEVSEDEKTKRARHD"
     atgcttcgag aagtaaagcc aaagaacccg cgcactgcac gcatcctcaa ggctaaagaa        60
     cctcaactca ttgaaggtgc aaagcgcgta ttgctgctcc atgggtcaaa atgtcctacg       120
     cccctacata ctgtcctcaa agttttccat tctcttacga caccgcattc cgtcctcttc       180
     cacaagaaaa atgagaacat tcacccgttc gagagtaccg agagtctcga attcctggcc       240
     aacaagaatg actgcggcat ggtaattttc ggaagcagca ataagaagag gcccaactgc       300
     ctgacaattg cgcgcatctt tgactccaaa gttctcgaca tggctgagct gttactcctc       360
     cccgatgcca atggcgaggg gattcccgag atgaacaggc tttctatgca tgtcgccatc       420
     ggtctgcggc cgctgatgct cttttccggc agcgcatggg acgatacgac atcgacgacg       480
     catacgatgc tgaagagcat gctggtggat ctattcaagg gcgagaccag tgataagatt       540
     gacgttgaag gactacagta tgcgcttatg gttggtgcgg aggagcctac ggcgggtctg       600
     gcacctatta ttcatctacg gtggtacaag atcgtcacta agcggagcgg acacaagctt       660
     cctcgcgtgg agctggaaga gattggaccc aagctcgact tcaaagtcgg acgtatccaa       720
     gaggcacctc gcgacgtcat gaaagaggcc atgaagcagg gcaagaaacc gaacgaggag       780
     atcaagaaca agaagaacat cggtattgat ttaatcggtg acaaggttgg tcgggtgcat       840
     ctagccaagc aggatctggg tggattgcag acgaggaaga tgaagggtct gaagcggagg       900
     gctggagtgg agtctgatga cgaaggagac gcagatatga tggatgtgga tgaagtttcg       960
     gaggacgaga agacgaagcg ggcacgacat gattaa                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page