(data stored in ACNUC16935 zone)

EMBL: BN001307.PE322

BN001307.PE322       Location/Qualifiers
FT   CDS_pept        complement(join(882347..882439,882493..882912,
FT                   882961..883334,883396..883510))
FT                   /locus_tag="ANIA_01485"
FT                   /old_locus_tag="AN1485.4"
FT                   /product="casein kinase II (Eurofung)"
FT                   /note="transcript_id=CADANIAT00008107"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008107"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008107"
FT                   /db_xref="GOA:Q5BD95"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD95"
FT                   /protein_id="CBF84962.1"
FT                   /translation="MARVYADVNKHMPRSYWDYDSVNISWGVLENYEVVRKIGRGKYSE
FT                   VFEGINIVNYQKCVIKVLKPVKKKKIKREIKILQNLAGGPNVVALLDVVRDNQSKTPSL
FT                   VFEYVNNTDFRTLYPRFSDYDVRFYIYELLKALDFCHSKGIMHRDVKPHNVMIDHEKRK
FT                   LRLIDWGLAEFYHKGTEYNVRVASRYFKGPELLVDFQEYDYSLDMWSLGAMFASMIFRK
FT                   EPFFHGNSNSDQLVKIAKVLGTEELFEYLDKYEIELDPQYDEILSRFPRKPWQSFVNAE
FT                   NQRFISDEAIDFLDKLLRYDHAERLTAQEAMAHPYFAQIRAEEAANRSTASS"
     atggcgcgcg tctacgctga tgtcaataag cacatgccac ggtcctactg ggactatgac        60
     agcgtgaaca tttcatgggg cgtcctggag aactacgagg tggtccgcaa aatcggccgc       120
     ggaaagtact cggaagtgtt tgaaggaatc aacattgtca actaccagaa gtgtgtcatc       180
     aaggttctaa agcccgtcaa gaagaagaag atcaagcgag agatcaagat tctccaaaat       240
     ctggcaggtg gacctaatgt ggtcgcgttg cttgatgttg ttcgcgacaa tcagagcaag       300
     accccgagtt tagtttttga atatgtcaat aataccgact tccgtacgct atacccgcgc       360
     ttttctgact atgatgtccg cttctacatc tacgaacttc tgaaagcgtt ggatttctgc       420
     cacagcaagg gcatcatgca tcgcgatgtc aagccgcaca atgtcatgat cgatcatgag       480
     aagcgaaagc ttcgcctgat tgattggggt ctagctgaat tctaccacaa aggcacggaa       540
     tataacgtgc gagtcgcctc acgctacttc aagggccctg aattgctcgt ggatttccaa       600
     gaatatgact actccctgga catgtggtcg ctcggtgcta tgtttgcttc gatgatcttc       660
     cgcaaggagc ctttcttcca tggcaacagc aactccgatc agttggtcaa gatcgccaaa       720
     gtgcttggaa ctgaggaact attcgagtat cttgacaaat atgagatcga gcttgatcct       780
     cagtacgacg agatcctttc ccgcttccct cgcaagcctt ggcaatcctt tgtcaacgcg       840
     gagaaccagc gattcatcag tgatgaagcg atagacttct tggacaagct acttcgttat       900
     gaccatgcag aacgcctcac cgctcaggaa gccatggctc atccttattt cgcacaaatc       960
     agagccgaag aggcggctaa tcgaagtact gcatcctcat ga                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page