(data stored in ACNUC16935 zone)

EMBL: BN001307.PE323

BN001307.PE323       Location/Qualifiers
FT   CDS_pept        join(883988..884063,884159..884169,884204..885037)
FT                   /locus_tag="ANIA_01486"
FT                   /old_locus_tag="AN1486.4"
FT                   /product="ribonuclease P complex subunit Pop2, putative
FT                   (AFU_orthologue; AFUA_8G04820)"
FT                   /note="transcript_id=CADANIAT00008108"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008108"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008108"
FT                   /db_xref="GOA:Q5BD94"
FT                   /db_xref="InterPro:IPR002738"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD94"
FT                   /protein_id="CBF84964.1"
FT                   /translation="MYYDLNVPYSPGDPEISATLSFLAEPNLTTINGKLPPNPTPPPLP
FT                   SDAPKDLTLLTRLNIPLSDPAQNQRLTSIAQAYDLVAVRPTNEKALLNACTNAECDIIS
FT                   LDLSIRHPYHFKFKMLSAAIARGIRFEICYGPGVTGSGLEARRNLIGNAMALIRAARGR
FT                   GIIVSSEAKRALGVRAPFDVINLACVWGLSQELGKEAISAETRKVTALARLKRTSWRGI
FT                   IDVVDGGQIPPASEAAASVAIVKDTGAKLNADNNGDNLKRKASTGPEPDADGPEKPLSK
FT                   REMKRRAKKARLEAALAGTDDSPAT"
     atgtactacg atctgaacgt gccttatagc ccgggtgatc ctgagatctc tgcaacgcta        60
     agctttctcg ccgaacctaa cctgacaact atcaacggaa aactcccccc aaaccctacc       120
     ccgccgccgc ttcccagcga cgccccgaaa gaccttacgc tcctcacgcg cctcaacata       180
     cccctctcag accccgcgca gaatcagcgc cttaccagta tagctcaggc ttatgatctg       240
     gttgccgtgc gcccaaccaa cgagaaagcg ttactgaatg catgcaccaa tgcagaatgc       300
     gacatcattt ccttagacct ctcaatcagg cacccttatc acttcaagtt caagatgctt       360
     tctgctgcta tcgctcgcgg tatccgcttc gaaatatgct acggcccagg agtcacagga       420
     agcggactag aagcacgtcg aaatctgatc ggcaacgcga tggccctgat tcgcgcagcc       480
     cgtggtcgcg gaatcattgt gtcgagtgag gccaaaaggg cattaggtgt ccgcgctccg       540
     ttcgatgtga ttaatctggc atgtgtatgg ggtttgtcac aggagctggg caaggaggcg       600
     atcagcgcgg aaacaaggaa agttactgct ctagcccgac tgaagcggac cagctggcgc       660
     ggtatcatcg acgttgttga cggtggacaa atccctcctg cttccgaagc agctgcttct       720
     gtggccattg taaaggatac aggtgctaag ctaaacgctg ataacaatgg cgacaatttg       780
     aaaaggaagg catctacagg ccctgagcca gatgcggatg ggcccgagaa gcctctttcc       840
     aagcgcgaga tgaagcgtcg ggccaagaag gctcggctcg aagccgctct agcaggcacc       900
     gacgattctc ctgcaacgtg a                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page