(data stored in ACNUC16935 zone)

EMBL: BN001307.PE324

BN001307.PE324       Location/Qualifiers
FT   CDS_pept        complement(join(886147..886651,886712..888246))
FT                   /locus_tag="ANIA_10201"
FT                   /old_locus_tag="AN10201.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008109"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008109"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008109"
FT                   /db_xref="GOA:C8VMG3"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMG3"
FT                   /protein_id="CBF84965.1"
FT                   /translation="MTSTAPTNQQHPPSGPSSEFSGNQPPASSGADQSTHISTSGYAPS
FT                   ENQLAGLVEAATAAAGQDVSEWAAAAAVAAAAGAAGNQHHLDGYAPDIQLDEDGFDEGG
FT                   YAGMTGARHYRGPGSTSGNEHGQSSGLARSGTKKRKRNEDALDPALAAASASLGQHHGQ
FT                   PQHQNQSQHHVHHASPYPGEGLEIRNTPPQTLADARAVGLHSAAALFRQTSTNKKYTRP
FT                   PMSKMFTSLELSPENFLHLQAAAKAYMLDDRHPERRDCVGQRGKGDTEMVKLRLWNCVR
FT                   HFLEVEGNGPRFFGEHVVNEGMPPRTYVWPRDQQKIISLVIPLLRRMVTNERQRQYAVE
FT                   TRKGGVEARRRRKTEDSIQDFRSASPPKFSSEDHLQMQADHQLPDGYSSTQHPLSASAP
FT                   PPPHSEPSVQVTELGLTDLILDGYSTDLDSISKSYDSYNHNYELDNLWSLSGLHLGDWR
FT                   GLVAAVDSHYQILHEGDYNCSGCCEDGNIGRILNSTSTADLRWRIGGDPARNEFASSIT
FT                   RDVSRVIRDNLAARQGAQNHTSLPQTQPIPPPLPFSHSSDLSNPNPPPAQSPLRLRINI
FT                   LQNGKRILPSYDLPATQGPDVTTVRQLVARKFAGELPGIPSDLNSDSNTWNASISWKFK
FT                   VWLPEGLVLIENDGDWTLALLAAEKVDWLDGELKVLVEIEDENQ"
     atgacgtcta ccgctccgac aaaccaacaa catcccccat ccggaccatc aagcgaattc        60
     tctggtaatc aaccacccgc ttcatccggc gcagaccaga gtacacacat ttcaacgagt       120
     ggatatgcgc cgagcgagaa tcagcttgct ggcttggtag aggccgctac agctgcggcc       180
     ggccaagacg tgtcggagtg ggcagcggca gcagcagtcg ccgcagcagc tggcgccgca       240
     gggaatcaac atcatctgga cgggtacgcg cctgacattc aattggacga ggatggcttt       300
     gacgagggag gctatgcggg catgactggc gcccgacatt atcgtggacc tggttcaacg       360
     tctggcaatg agcacggtca atcctcgggt ttggctcgat cggggacgaa gaagagaaag       420
     agaaacgagg atgctcttga tccggctttg gctgccgcaa gcgcgagtct cggccagcat       480
     cacggtcaac cgcaacatca gaatcaaagt caacaccacg tccaccatgc aagcccgtac       540
     ccaggggagg gactggaaat tcgcaatact ccgccgcaaa cgcttgcgga tgcccgcgcc       600
     gttggactgc actccgctgc agcactattc cgtcaaacct caaccaacaa gaagtatact       660
     aggcctccca tgtcgaagat gttcacttct ctggagctat cgccggaaaa ttttctacat       720
     ttacaagctg cggctaaagc atacatgcta gatgataggc atccggagcg ccgtgactgc       780
     gtaggccagc gcgggaaagg agatacagag atggtcaaat tacggttatg gaactgtgtc       840
     cgtcacttcc tcgaggtcga gggcaatggc ccgcgattct tcggtgaaca tgtggtcaac       900
     gagggtatgc ctcctcggac atacgtctgg ccaagggacc aacagaaaat catctcactc       960
     gttattccgt tgttgaggcg catggtcaca aacgaacgac aacgacaata cgctgtcgaa      1020
     accaggaaag gtggcgtgga ggcacgaaga aggcgaaaaa cagaagatag tatccaagac      1080
     ttccgcagtg cgagtccacc caagttctca tccgaggacc accttcagat gcaggcggat      1140
     catcagcttc ccgatggata tagctcaact caacaccctc tatcagcgtc tgccccgcca      1200
     ccacctcaca gtgaaccatc tgtgcaggtc acagaactgg gccttactga tcttatcctg      1260
     gatggttata gtacagactt ggattctatt tcaaagtcgt atgattcgta caaccataac      1320
     tatgaacttg ataacctatg gtctctctcg ggcctacatt taggcgattg gcgcggtctt      1380
     gtggctgcag ttgatagcca ctatcagatt cttcacgagg gagactataa ttgcagcggt      1440
     tgttgtgaag acggcaacat aggacgcatt ctcaattcga ctagcaccgc agatctacga      1500
     tggcgtattg gcggcgaccc tgccaggaat gagttcgcaa gtagcatcac ccgcgacgtc      1560
     tcacgggtta tccgcgacaa tctagcagct aggcaaggcg ctcaaaacca cacatcactg      1620
     ccccaaaccc agcctatccc accgcccctt cccttttctc attcatccga cctttcaaac      1680
     cccaatcccc ctcccgccca atcgcctctc cgcctccgca tcaacattct gcaaaacggg      1740
     aagcgcatcc tcccttccta tgaccttccc gctactcagg gtccagacgt cacaaccgtg      1800
     cgccagctcg tagcgcgcaa attcgccggt gaacttcctg gtatcccttc agacctgaat      1860
     tcggactcca acacctggaa cgcatccata agctggaaat ttaaagtttg gctaccggag      1920
     gggcttgttc tcattgagaa tgatggcgat tggacgctgg cgctccttgc cgcggagaag      1980
     gtggactggc ttgatggcga gctgaaggtt cttgttgaaa ttgaggatga gaatcagtag      2040
//

If you have problems or comments...

PBIL Back to PBIL home page