(data stored in ACNUC16935 zone)

EMBL: BN001307.PE325

BN001307.PE325       Location/Qualifiers
FT   CDS_pept        complement(888915..890129)
FT                   /locus_tag="ANIA_10196"
FT                   /old_locus_tag="AN10196.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008110"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008110"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008110"
FT                   /db_xref="GOA:C8VMG4"
FT                   /db_xref="InterPro:IPR021838"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMG4"
FT                   /protein_id="CBF84967.1"
FT                   /translation="MATTRRFVPLLGCGFFFFCLWGLFSLSRSWTQMKVSQAVGLGELV
FT                   STPSPTPSGYWNVTEGPKQPFAPRPQYVAGIARPDGHEYTKTLVIPRTTYEDTSWTEFE
FT                   IPGWETAVYVVDDPSAPLHPPKNKGHEVMVYLSYIIEHYDELPEIIAFMHSHQFGWHND
FT                   DLLDGNAATILQRLRPERVIREGYMNLRCGWGPGCPDWLHPGTLEEDESKQEEILLARS
FT                   WGEIFPDDPIPDVLAQPCCAQFAVSRERVHAIPRARFVFYRDWVLRTELSDYISGRIWE
FT                   YLWHVIFTGQNVVCPKEHVCFCDGYGICFGGEDEYNAYRNMDSEREAWEDELKRWRSRA
FT                   AVIESARRRGTLGEKSHLSVPEPGRDIELEELIARHGELKEELLLNATIRGQDAKARAL
FT                   EVGIW"
     atggcgacaa cgcgccgctt cgttcctctt ctcggctgcg gcttcttctt tttctgctta        60
     tgggggctat ttagtctgtc cagatcatgg acgcagatga aagtgtcgca agccgtcggc       120
     ttaggcgaac tcgtttctac gccgtcacca actccgtccg ggtactggaa tgtcactgaa       180
     ggaccaaagc aaccgttcgc gccgcgtccc caatatgtcg ctgggattgc cagaccagat       240
     ggacatgagt acacgaagac gttagtgata cctcggacaa cctacgaaga tacctcgtgg       300
     acggagtttg aaatccccgg ctgggaaacc gctgtatacg tcgttgacga cccatccgcg       360
     cctctgcatc cgccgaagaa taaagggcat gaggtcatgg tctatttgag ttacatcatt       420
     gagcactacg atgaacttcc agaaataatt gctttcatgc actcgcatca atttggatgg       480
     cacaacgacg accttcttga cgggaacgcg gcaaccattt tacaacgttt gcgaccagag       540
     cgggtcatca gggaaggcta tatgaacttg cgctgtggct ggggtcctgg ctgtcccgat       600
     tggctgcacc ccggtactct ggaggaggat gaatccaagc aggaagaaat actacttgcc       660
     agatcctggg gcgagatctt tcccgatgac cctatcccgg acgtgctggc gcagccgtgc       720
     tgtgctcagt tcgccgtctc gcgcgaacga gtgcacgcta ttccccgggc gcgctttgtc       780
     ttctatcgag attgggttct tcgcacagaa ctgagcgatt acatctctgg tcgtatttgg       840
     gaatatcttt ggcatgttat ttttacaggt cagaatgtgg tctgcccgaa agagcatgtg       900
     tgcttttgcg atggatatgg aatctgtttt ggtggcgagg acgaatataa cgcctaccga       960
     aacatggact ccgaacgcga agcttgggaa gatgagctta aacgttggcg cagtcgagcg      1020
     gctgtgatcg agtctgctcg gcgtcgcggt actcttggag agaaaagtca cctatctgtt      1080
     ccggaaccgg ggcgagacat tgaactcgag gaactcatcg cgcgacatgg tgagctgaaa      1140
     gaggagctgt tgctcaacgc taccatacgc ggacaggatg ccaaggcgcg agcccttgag      1200
     gtggggattt ggtga                                                       1215
//

If you have problems or comments...

PBIL Back to PBIL home page