(data stored in ACNUC16935 zone)

EMBL: BN001307.PE326

BN001307.PE326       Location/Qualifiers
FT   CDS_pept        complement(join(891217..893415,893477..893581,
FT                   893638..893661))
FT                   /locus_tag="ANIA_01488"
FT                   /old_locus_tag="AN1488.4"
FT                   /product="RING finger protein (AFU_orthologue;
FT                   AFUA_8G04840)"
FT                   /note="transcript_id=CADANIAT00008111"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008111"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008111"
FT                   /db_xref="GOA:Q5BD92"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR024766"
FT                   /db_xref="InterPro:IPR032832"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD92"
FT                   /protein_id="CBF84968.1"
FT                   /translation="MRFAAYAGASVALATGVFLKALHQRANFYSACVYLSQSSANLMIL
FT                   TNVCLLAVGFLLFWLQRLLYGPLRPIETEQLYEKAWFAVTETCLAMTIFRGELGAWFLV
FT                   MFVSLLVGKVWGWIGEGRVEFLEQQPPANPLLFHTRLVVSLLLSVMFDIFMLKYCIDTV
FT                   LEQARPDMMVMFGFEFAVLTILSTSTAARYSISLVEIYINRQQMKARIEERRQEIRAAR
FT                   EQALAEHAATEDQTANLDLPDENDINELELDIPGWEEKGRWVFYLDLLTDFLKLTVYLT
FT                   FFAILFTFYGLPIHILRDVVVTIRSFGRRIMDFARYRNATRDMNDRYPDASAEEVAREE
FT                   VCIICREEMTHWQPGDRPVSRVSERLRPKKLPCGHILHFSCLRSWLERQQNCPTCRRPV
FT                   IAPPRNQGPAGVNMGQGNGGAGQQQNMPPGNQPVNQNPPADGLPRARIYQFGPFRIGFG
FT                   AGRGDLFNNLHQQIHQGNGPWQPGMNPNPAGARQIGFGFGFGRPPLQQAPAPAAPAATQ
FT                   PVPTPTSNLPNLQNQLLQMEQQIANEINGLRIAADQLNLVRLLQTELQRLRTLQSQPLN
FT                   NQTNIPQNPSPSIPSISPTTTRPRIVSNPETAPMGAGDPRLPDGLTLPQGWTLVPLHSV
FT                   QPGLSASSNVAANASSSEAEHSAPPSEGMLNSQVPTDTESQRPSDRSDAATSGSSGLPN
FT                   WQSSPFSHSAADSTGAISQQSENLSSEAGLRAPLAPSKTEQVETPLSEHGAETRIETQT
FT                   SDSRSKGKERVATVEDAADDET"
     atgagattcg ctgcctatgc tggggcctcg gtggctctag caacaggtgt attcttgaaa        60
     gcacttcacc agagggcaaa tttctattcc gcttgcgtgt atctttccca gagtagcgcc       120
     aatctcatga tcttgacaaa tgtttgtctt ctggctgtcg gtttcctgct cttctggctt       180
     cagcgccttc tctacggccc ccttcgacct attgagaccg agcaacttta cgagaaggcg       240
     tggttcgcgg tgacggaaac atgcttggct atgacaatat tccgcggaga gcttggggcc       300
     tggttcctgg tcatgtttgt gtccttgctt gttgggaagg tatggggctg gattggggag       360
     ggccgcgtgg agtttctcga acagcaaccc ccagcgaacc ccctcttgtt tcataccagg       420
     ctggtagtct ccttactttt atcggtgatg tttgacatct tcatgctgaa atattgcatc       480
     gatacggtcc ttgaacaagc ccgcccggat atgatggtca tgttcggctt cgaatttgct       540
     gttctcacaa tcctctcgac ctccactgct gccaggtatt cgatttcgct tgtggagata       600
     tatatcaatc gccagcagat gaaggctcgc attgaggagc ggcgccagga gattagagct       660
     gctcgcgagc aggccctggc ggagcacgca gcgacagaag atcaaaccgc aaaccttgat       720
     ttacccgatg aaaacgacat caatgagttg gagctcgata tcccaggttg ggaagaaaag       780
     ggccgctggg tcttctatct agatctactc accgacttcc ttaagctcac cgtttatctg       840
     actttcttcg ctattctatt tacgttttac ggtttaccca ttcatattct ccgggatgtt       900
     gtggttacga ttcgctcatt cggacggcga attatggact ttgctcgata ccgaaacgcc       960
     acacgtgata tgaacgacag atatcctgac gcgagtgctg aggaggtcgc gagagaagag      1020
     gtctgtatca tttgccggga ggagatgacc cattggcaac ccggagacag accagtttct      1080
     cgagtttcgg aaaggttacg ccccaagaaa ctcccgtgcg gccacatttt acatttctct      1140
     tgccttcgaa gctggcttga aagacagcag aattgtccca catgtagacg accggtcatt      1200
     gcgcctccac gtaaccaagg acctgctggg gtcaatatgg gacaaggaaa cggtggtgct      1260
     ggtcagcagc agaatatgcc tcccggaaat cagccagtca accaaaaccc cccagcagat      1320
     ggccttccta gggctcgaat ttaccaattc ggtccattta ggatcggatt tggcgcggga      1380
     agaggggatc tcttcaacaa tctgcatcaa cagattcatc agggcaacgg tccttggcag      1440
     ccaggtatga atcctaaccc tgctggcgcc agacaaattg gctttgggtt cggcttcgga      1500
     cggcctccgc tgcaacaagc gcctgcaccg gctgcaccag ctgcaaccca gccggtcccg      1560
     acgcccactt cgaacctgcc caacctgcaa aaccaactcc tgcagatgga gcaacaaatt      1620
     gcgaacgaga tcaatggcct gcgcatcgct gcggatcagc tgaacctcgt tagattactg      1680
     cagacagagc tccaacgcct tcgtactttg caatcgcaac cattaaacaa ccagactaac      1740
     attccgcaaa atccctctcc atcaatacct tcaatatccc ctacaactac acgccctcga      1800
     attgtctcta acccggaaac ggcgcctatg ggagctggtg accctcgtct accagatgga      1860
     ctgacacttc cccaaggctg gaccctggtt cccctccact ctgtacaacc aggactgagc      1920
     gcatcctcga atgttgccgc aaatgcttct tcatcggagg ctgaacatag tgctccacca      1980
     tctgaaggga tgctcaactc ccaggtaccc actgacactg agagtcagag accgagtgat      2040
     aggagcgatg ccgccacctc cgggagttca ggtttaccaa actggcagtc aagccccttc      2100
     tcgcactcag ctgcagacag caccggagct atttcccaac agtcagagaa cctcagttcg      2160
     gaggctggac tgagggcgcc tctggctccc tcgaagactg agcaagttga gactccactt      2220
     tccgagcacg gcgcagagac taggattgaa acccagactt cggattcaag atccaaaggg      2280
     aaggagcggg tagccacggt agaagacgca gcggacgatg agacatga                   2328
//

If you have problems or comments...

PBIL Back to PBIL home page