(data stored in ACNUC16935 zone)

EMBL: BN001307.PE329

BN001307.PE329       Location/Qualifiers
FT   CDS_pept        complement(join(900232..901260,901313..901593,
FT                   901653..901697,901746..901887))
FT                   /locus_tag="ANIA_01491"
FT                   /old_locus_tag="AN1491.4"
FT                   /product="COP9 signalosome complex subunit 1 (CSN complex
FT                   subunit 1) [Source:UniProtKB/Swiss-Prot;Acc:Q5BD89]"
FT                   /note="transcript_id=CADANIAT00008114"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008114"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008114"
FT                   /db_xref="GOA:Q5BD89"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR019585"
FT                   /db_xref="InterPro:IPR033008"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5BD89"
FT                   /protein_id="CBF84973.1"
FT                   /translation="MEPMLPEAGEAALLSSYAPQASGSMGVDPDPITGLVSTSAAPLVR
FT                   VEEAPKFELESYIANYTGRTRFNRLYLIGTCSSYLAVDALKAAIAEAKSGKDVARYLRA
FT                   VQALADVAPNEPEATIDSDWVERSQKVVKAETDRLEHELRGYKNNLIKESIRMGNEELG
FT                   QHYHRIGDLTSAFKAYSRMRDFCTTPSHIASMLFKIINVAIERGDWLNVQSNVHRLRSQ
FT                   GGKPEEQAKHQPKISAAMGLSQLHSGSYLEAANSFIATDPSLGDTFNEVLTSNDVAVYG
FT                   GLCALASMDRNELQRRVLDNSSFRNFLELEPHIRRAISFFCNSKFRPCLEILEAYRADY
FT                   LLDIHLQRHVQVLYNRIRTKSIQQYLIPFNRVSLESMAKIFVLGNPTSQSSQSDSKSAF
FT                   VQELISLIQDGTLDARIDLEKHVLVSTQGDKRIEVQEAVLDSLDNYVREAHLRLLRSNI
FT                   IRAGLEVRPLGEDRRTKLEERGKKGHSAIGNLLRATGMKQ"
     atggagccca tgttaccaga agccggcgaa gcagccctat tgagttcata tgcaccccag        60
     gcctcgggct ctatgggagt agatccggat ccaattactg gccttgtatc tacttctgcg       120
     gcgccgttag tcagagtgga agaagcacct aaattcgagc tggaatccta catcgcaaat       180
     tataccggcc ggactcggtt caatcgatta taccttatcg ggacctgctc ctcgtacctt       240
     gctgttgatg ccctcaaagc tgcaattgcg gaggccaagt ctggtaaaga cgttgctcgg       300
     tacctgcgcg cagttcaagc acttgcggat gttgcaccaa atgagcccga ggctaccatt       360
     gactcggact gggtggaaag gtcacagaag gttgtcaaag ccgagacgga ccgattagag       420
     catgagctta ggggatataa aaataacttg attaaagaga gtatccggat gggaaatgag       480
     gagctcggcc agcattacca tcggatcggc gacctgactt ctgcattcaa ggcttattcc       540
     cgtatgagag acttctgcac aacccccagt cacatcgcgt cgatgttgtt caagatcata       600
     aatgtggcga ttgagcgcgg ggactggctg aacgtacaat ccaatgtgca tcggctccgg       660
     agtcaggggg ggaagccgga agaacaagcc aaacaccagc ctaagatttc agcagccatg       720
     gggctatcac agctacattc cgggtcatac ttagaagccg caaacagctt cattgcgacg       780
     gaccccagct taggggacac gtttaatgaa gttctgacct cgaacgacgt cgcggtatac       840
     ggcggtctct gtgccctagc ctccatggac cgcaacgagc ttcagcgccg tgtcctggac       900
     aatagttcgt tccgcaactt cctagagttg gagcctcaca tccgccgcgc tatttcattc       960
     ttttgcaact ccaaattccg accatgtctc gaaatcctcg aagcataccg agctgactac      1020
     ctgctcgaca tccacctcca gcgccatgtt caagttctat acaaccgaat ccgaacaaag      1080
     tctattcaac aatatcttat tcccttcaac cgtgtctcac tcgaatctat ggccaagatc      1140
     ttcgttctcg gaaaccccac aagccagtcc agtcaaagcg actcaaagtc agcctttgtc      1200
     caggaattga tcagcctcat ccaagacggc acgttggacg ctcgtatcga ccttgagaag      1260
     catgtcctcg tttccaccca aggcgataag cgcatagaag tgcaagaagc agtcctcgac      1320
     agtctagata actacgttag ggaagcacat cttcggctgc tacggtcgaa tattatccgt      1380
     gctggtttag aggtgcgtcc gttaggagaa gaccgccgta cgaaactgga ggagagaggg      1440
     aagaagggcc atagtgctat tgggaacttg ctccgggcga cggggatgaa gcaataa         1497
//

If you have problems or comments...

PBIL Back to PBIL home page