(data stored in ACNUC16935 zone)

EMBL: BN001307.PE330

BN001307.PE330       Location/Qualifiers
FT   CDS_pept        join(904258..904903,905098..905258)
FT                   /locus_tag="ANIA_01492"
FT                   /old_locus_tag="AN1492.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008115"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008115"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008115"
FT                   /db_xref="GOA:Q5BD88"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD88"
FT                   /protein_id="CBF84974.1"
FT                   /translation="MPFATPIKTSAGITLPVDLKEASVETASMTTAIVAHTLRGMDCMS
FT                   YKISTGFAVGSNKKLDLASNKWWLLISFDTPKNAKPTWEEDIIRDLMNRLGLPVSEAIP
FT                   PSDRDSALLQAQNGEQSSRMARIRSKIRTMQQTSRLNSLKSRLDSLTLHHEKTVRVYDD
FT                   IPFLLSYGAHDADFAIYDELCRHLQAGGETRLCGFAFTLRELQTWDKIDERLDQFSPSF
FT                   CIVALNVAILAPYSDHSCSKADGGSRFLNPGKLSLHITSSIAMQNQ"
     atgccttttg caactccgat taagacgtcg gcgggaatta ctctgccagt cgatctcaag        60
     gaagcctctg tggagacggc atcgatgacc accgcaattg ttgcgcatac cttacgcggt       120
     atggactgta tgagctataa gataagcaca ggatttgccg tcggaagcaa caaaaagctt       180
     gacctcgcgt cgaataaatg gtggctgctt atatcctttg atacacccaa gaacgccaaa       240
     ccaacctggg aagaagatat aatacgtgac ctgatgaaca ggctgggtct accagtttct       300
     gaggccattc cacccagtga ccgtgatagt gccctattgc aagctcaaaa cggcgagcag       360
     tccagtcgca tggcgagaat caggtcaaag atccggacta tgcagcagac atcccgcctc       420
     aacagtctga aatcccgtct ggacagcctg acgcttcatc atgaaaagac agtcagggtg       480
     tacgacgata tacctttcct tcttagttat ggggcgcatg atgcagattt tgctatctac       540
     gacgaattat gccgtcatct gcaggcgggt ggtgagacca gactctgtgg tttcgccttt       600
     acactgaggg agctccaaac ctgggataag atagacgaga gactagatca attttcccca       660
     tcattctgta ttgttgcttt gaatgttgcg atacttgctc cttactcaga ccattcttgt       720
     tccaaggcgg atggaggaag ccgatttctc aatcccggta aactctcact tcatataacc       780
     agttccattg ccatgcaaaa tcagtag                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page