(data stored in ACNUC16935 zone)

EMBL: BN001307.PE331

BN001307.PE331       Location/Qualifiers
FT   CDS_pept        complement(join(905426..905815,905911..906005,
FT                   906064..906175))
FT                   /locus_tag="ANIA_01493"
FT                   /old_locus_tag="AN1493.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008116"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008116"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008116"
FT                   /db_xref="GOA:Q5BD87"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD87"
FT                   /protein_id="CBF84976.1"
FT                   /translation="MVLFRSVLAFASVAGLAISQDASTTTVDIQSLDDGTKKQWCIAQT
FT                   SSCPLLCLQLPGASGDPTSNTCDDDTLAYNCVCDNGQSPNASEYSQTIPYFLCTEENNN
FT                   CVAACSQGDSSCQDSCRTSNPCGAQNPKLVNTTSTNGSSTATSTTTSTTSSLAPFTGLP
FT                   DDDEGAAVRPVTDLRQVYGLFAVLGGFFAGFTILL"
     atggtcctgt tccgctccgt gctcgctttc gcctctgtgg ctggccttgc aatcagccaa        60
     gatgccagta caacaacggt agatatccag agcctcgacg atggcacgaa aaagcaatgg       120
     tgcatagcac aaacctcctc ctgccctctt ctctgcctgc agctccccgg cgcatccggt       180
     gacccaacat ccaacacctg cgatgatgac acgctagcct ataactgcgt ctgcgacaac       240
     ggccaatccc ccaacgcctc cgaatactcc caaacgatcc cgtacttcct ctgcacggaa       300
     gaaaacaaca actgcgtggc cgcttgcagc caaggcgact ccagctgcca ggacagttgc       360
     cgcaccagca acccatgcgg tgcgcagaac cctaaactcg tcaatacgac ttctaccaat       420
     gggtcttcga ccgcgacgag cacaactacc tccaccactt cttctctcgc gcccttcacg       480
     ggcctgcctg atgatgacga gggcgctgct gtaaggcctg tgacggattt gaggcaggtg       540
     tatgggcttt ttgccgtgct aggtggattc ttcgctggtt ttacgatttt gctctag          597
//

If you have problems or comments...

PBIL Back to PBIL home page