(data stored in ACNUC16935 zone)

EMBL: BN001307.PE332

BN001307.PE332       Location/Qualifiers
FT   CDS_pept        join(907137..907199,907915..908412,908499..908551,
FT                   908637..908673,908736..908780)
FT                   /locus_tag="ANIA_09515"
FT                   /old_locus_tag="AN9515.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008117"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008117"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008117"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AQB5"
FT                   /protein_id="CBF84978.1"
FT                   /translation="MSWKDADAGPCPSSQKRIRGLALPPPISGSEVSKWMAPANEETGR
FT                   VPRPQPLPASPHPSSGIPSAPDRDGDAVEPADSNPGEISANPSSASSSRSQLESPNLAP
FT                   KERPVSGIVPPYWSHHRNASRASQISADGGPAITLEDHTEDPNSETSRGLWAKSVTIDD
FT                   HVVVQGKSGVGAYVVWNCKIRTLEGGTITVRMRYSYGSAIISTPSQRYPRRVFYSSFGH
FT                   LSLNLAKLV"
     atgtcttgga aagatgcgga cgctgggccc tgcccgtcct cacagaagag gattaggggt        60
     ctggcattac cacctcctat ttccggctct gaagtatcta aatggatggc tccagcgaat       120
     gaggagactg gccgggtacc gaggccgcag ccgctccctg cttcccctca tccttcaagc       180
     ggtattccca gcgcccccga tcgtgacggg gacgcggtag aaccagccga ctcgaatcca       240
     ggcgagatca gtgccaaccc tagttcagcc tcttcatccc gctcccagtt ggagtctccc       300
     aacctcgcgc ccaaagaacg tccagtttca ggcatagtac ccccgtactg gagccatcat       360
     cggaatgcgt ctcgtgcatc gcagatttcc gccgacggag gacccgcgat aaccctcgaa       420
     gaccatactg aggatccgaa ttccgagact agccgtggct tgtgggctaa gagtgtaacg       480
     attgatgatc atgttgttgt tcaaggaaag tccggggtag gcgcgtacgt ggtatggaat       540
     tgcaagatcc gaacgttgga gggtgggacg atcacagttc gcatgaggta ttcttacggc       600
     tccgccatca tatcaacgcc ctcccaacgc tacccccgaa gagtgttcta ttcaagtttc       660
     ggccatcttt ccttgaatct cgcaaagttg gtctag                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page