(data stored in ACNUC16935 zone)

EMBL: BN001307.PE333

BN001307.PE333       Location/Qualifiers
FT   CDS_pept        join(913046..915361,915409..915777,915829..916620,
FT                   916685..917056)
FT                   /locus_tag="ANIA_01494"
FT                   /old_locus_tag="AN1494.4"
FT                   /product="transcription initiation factor TFIID subunit
FT                   TSM1/127kD, putative (AFU_orthologue; AFUA_8G04950)"
FT                   /note="transcript_id=CADANIAT00008118"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008118"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008118"
FT                   /db_xref="GOA:Q5BD86"
FT                   /db_xref="InterPro:IPR037813"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD86"
FT                   /protein_id="CBF84980.1"
FT                   /translation="MPGVVDTPAGPSWPGLGFTVAHQKVELELDFASRSLKGKTEIIIH
FT                   PHYKDLRYIRLNFRQGELKRVTVSGKVPLVKYTDPYESLQLYGPHYHQRLASKLDALLK
FT                   TPSEPELTLTLPKSVRIDELDPFSVEAQDQMALRAPGLADDTEGPLSSKTAETSLPRFT
FT                   ALTVTIEFIVENIRDGIQFVGVENGDKRYPHAYTTNSLDHGTGCPLFPCVDDPSSRCTW
FT                   EIAIRCPCTLGDVFERKPRDQSVSGTGTRLRSNHDRLAPDDEALDLSVVCSGELTDDIV
FT                   DSKDSSKKTVSFASYSPLSARQIGFAVGPFEYVNLADFRESDQDEQLGQNAIPLHAFCL
FT                   PGRGDEVRNTCFPMAKAIDFFSMTYGSYPFSSYKMCFVDDAPEDTLPTACFSICSSRLL
FT                   FPEEIIDPMYDSTRAITHALAAQWIGVNIVPKEPADTWVTVGVAWYITDTFMRKLCGNN
FT                   EYRFRLKLMSDRVCDLDYERPSVYDMGNILSIDPSEAKFIALKAPLVLFILDRRLTKAS
FT                   GKATMSRIISRLFLNARMGELPNGAVTSSVFQKTCERLGHAKLDTFFNQWIYGAGCPRF
FT                   QATQRFNKKKLVVEMMIKQVQSDQPTARDLERDAFMRDVKEEIRNVYAGTIQPVFTGSM
FT                   TIRIHEADGTPYEHIVEIKEGVTKFDIPYNTKYKRLKRNKRQKERAAAVIGADGNAEVQ
FT                   EDILLYCLGDVLQSEEEMQQWRLADWSKEDEERMGQESYEWIRMDADFEWICKLSLVMP
FT                   GYMYLSQLQQDRDVVAQLESLQYMAAQREHPLISTIFLRTLMDRRYFYGIRVAAARALV
FT                   KHAKEEINWLGLFHLEKAFQELFCLPGSPMTRSNNFSDRAAYVLQLVIPEAISKVRDVS
FT                   GKTPMRVKRFLYDKLKFNDNSNNEYSDNFYVATLMKSLCHAMLGRVESRTDDLNNFDMD
FT                   AVLEAQAEEQLEKDAIAEIDRYRRMDEWSSSFQNLYSRAALYCQMQLMQAKIAEVDVMQ
FT                   FLPYTRVGTYDLLRLDAFECLVELDIFKSPELLRWFIFTMSNDPSIWLRWQLHGLFGRA
FT                   LAPVAFGRGVINEPPPPTDGLIIEQESSTEVRQADLARRQTVTGALAALKAEVSGDQVL
FT                   KECLWAACSSPIIGILELSEFTDLCRVIYDPVTSKRVTLKYPRYWAVKHHGRGRLQFYR
FT                   TNKIRTSLNPSTTSSAKRKREDGTAMPAPSSGLRVTFKQSRPNPSNHHPSTPSAKTPGP
FT                   SSGLGTPLQQRQPTKLHIPNFAAAQVHRQPPSHTPATPSTPGGGLKLKLKLGSQPKQ"
     atgccaggcg tcgtagatac tcccgccggc ccaagctggc caggtctggg atttacggtc        60
     gcgcatcaaa aggttgagct agagttggac tttgcgagtc ggagtctgaa gggcaaaacc       120
     gagatcatca tccatccgca ctacaaagac ctgcgttaca ttcgtttgaa ctttcgacag       180
     ggagaattga agcgtgttac agtcagtgga aaagtgcctc tagtgaagta cacggatcct       240
     tacgagtcgc ttcaactata cggccctcat taccaccaac gcttagcgtc aaaactcgat       300
     gccctcctca aaacaccttc cgagcccgag ctcaccctta ccctcccgaa aagcgtccga       360
     atagatgaac ttgatccgtt ctctgtcgag gctcaagacc agatggcact gcgggcgccc       420
     gggctggctg atgataccga ggggcctcta agctcgaaga ccgccgagac atcccttcct       480
     cgattcacgg ctctcacagt tactattgaa tttattgtcg aaaacatacg agatgggata       540
     cagtttgttg gagtggaaaa cggggacaag cgctatccac acgcttatac gacaaactct       600
     cttgatcacg gcaccgggtg tccgctcttc ccttgcgttg atgatccttc ttcacgatgc       660
     acttgggaaa tagcgatcag atgcccgtgt actcttggcg atgtgtttga acgcaaacct       720
     cgagaccagt cagttagtgg gaccgggact cgcctaagat caaaccacga tcggcttgcc       780
     ccagatgatg aagccctaga cttgtccgtc gtctgttctg gggagctgac ggatgacatt       840
     gttgattcaa aagattccag caagaagact gtctcgtttg cttcctactc tcctctctcc       900
     gcacggcaga ttgggtttgc tgttggtcct tttgagtacg tcaacctcgc tgacttccgg       960
     gaaagtgacc aagacgagca gcttggtcaa aacgccatcc cactgcatgc gttctgcctt      1020
     ccgggtagag gcgatgaagt tcgcaacact tgctttccta tggcaaaggc tatcgacttt      1080
     ttctcaatga cttacggatc atacccgttt tcaagctata aaatgtgctt cgttgatgat      1140
     gcgccggaag acacattgcc aacagcatgc ttttcgatat gcagcagccg tcttctgttt      1200
     ccagaggaga taattgaccc aatgtacgac tctactcgtg ccatcactca cgctctagct      1260
     gctcaatgga tcggtgtcaa tatcgtgcca aaggaaccgg ctgatacttg ggtaacggtt      1320
     ggcgttgcct ggtacatcac agacacgttc atgcgcaaac tttgcgggaa taatgaatat      1380
     cgttttcggc tgaaattgat gtcagaccga gtgtgtgacc tggattatga gcgtccatcg      1440
     gtgtatgata tgggaaacat cttgagcata gacccatcag aggccaaatt tattgcgctc      1500
     aaagcgccgt tagttctctt catcctcgat cgacgcctca ctaaagccag cgggaaagca      1560
     accatgtcgc ggattatctc tcgtcttttc ctgaatgctc gtatgggaga actaccgaat      1620
     ggggctgtca cgtcctcagt tttccaaaag acgtgtgagc gtttgggaca cgcaaaactg      1680
     gatacctttt tcaaccaatg gatttatggt gctggttgcc cccggttcca agccacgcag      1740
     agattcaaca agaagaaatt ggtggtggaa atgatgatca aacaggttca gtcagatcag      1800
     ccgaccgctc gcgatctaga acgggatgcg tttatgcgcg acgtcaaaga agaaattcga      1860
     aatgtttacg ccggtacaat acaacctgtt tttaccggct caatgacgat caggattcac      1920
     gaagctgacg gcacaccata tgaacacatc gtggagatca aagaaggtgt cacgaaattt      1980
     gacataccct ataatacgaa atataaacga ctgaaaagaa ataagcgaca gaaagagcgt      2040
     gctgctgctg tcattggtgc tgatgggaac gcggaagtgc aggaggacat tctgctatac      2100
     tgtcttgggg atgtattgca gagcgaggag gagatgcagc aatggcgact tgctgactgg      2160
     agcaaagagg atgaagaacg aatgggtcaa gaatcttatg aatggattcg catggatgca      2220
     gattttgaat ggatctgcaa gctttcgttg gttatgccag gatacatgta cctttcacag      2280
     ctccagcaag atcgagatgt ggtagctcaa ttggagtccc tacagtacat ggccgcgcaa      2340
     cgcgaacacc ctctgatctc tacgatcttt cttcgaacgt taatggaccg acgatatttc      2400
     tatggaattc gggtggcggc ggctcgtgct ttagtgaaac atgccaaaga agaaatcaac      2460
     tggctagggc tatttcatct cgagaaagct tttcaagagc tattctgcct gccgggatct      2520
     cctatgactc ggtcaaataa cttctcagat agggccgcgt atgtccttca gctagtcatt      2580
     cccgaggcaa tttccaaagt gcgcgacgtc agtggtaaga ctcccatgag ggtgaagcgg      2640
     tttctttatg acaagctgaa gttcaacgac aactccaata atgagtactc ggacaacttc      2700
     tacgtggcca cattgatgaa gtccctatgt cacgccatgc ttggaagagt tgagtcccgt      2760
     actgatgacc tgaacaattt tgatatggac gccgttctag aagctcaagc cgaagaacag      2820
     ctggagaagg acgctattgc ggaaatcgac cgatatagga gaatggacga gtggtcaagc      2880
     tctttccaga acctctactc ccgcgcggct ctatattgcc aaatgcagct gatgcaagct      2940
     aaaatagctg aagtcgacgt tatgcaattt ctaccctaca cgcgggtagg cacttatgac      3000
     ctccttcgcc tggacgcttt cgaatgcctt gtcgagctgg acatcttcaa aagccccgaa      3060
     ctgcttcggt ggttcatttt caccatgtca aatgacccgt ccatatggct caggtggcag      3120
     cttcacggcc tatttggtag ggcactcgca cctgtcgcat tcggccgagg cgtaatcaac      3180
     gagccaccac ccccaaccga tggtctaata atcgagcaag agtcctcgac agaggttcga      3240
     caggctgatc ttgctcgaag gcaaaccgtc actggggctt tggctgctct caaagctgag      3300
     gtctccgggg accaagtgct caaagagtgt ctctgggccg catgcagttc gccaataatc      3360
     ggcatcctag agctctccga attcacggac ctttgtagag tcatatatga tccggtcact      3420
     tctaagagag tcaccctgaa atacccccgc tactgggcgg tcaagcatca tggaaggggt      3480
     cgcctccagt tttaccgcac aaacaaaatc cgcacttccc tcaacccctc aaccacatcc      3540
     tccgcaaaac gcaaaagaga agacgggaca gccatgccag cccctagttc tggcctccgc      3600
     gtcacgttca agcagtcaag accgaacccc agcaatcacc accccagcac cccctccgcc      3660
     aaaaccccag ggccaagttc aggtcttgga actcccttgc aacaaagaca gcccacgaag      3720
     ctacatattc cgaacttcgc tgcagcgcag gttcaccgtc agccgccgtc acacaccccc      3780
     gcgactccgt ctacgcctgg tggcgggctc aagctgaaat tgaaacttgg gtcccagcct      3840
     aagcaataa                                                              3849
//

If you have problems or comments...

PBIL Back to PBIL home page