(data stored in ACNUC16935 zone)

EMBL: BN001307.PE335

BN001307.PE335       Location/Qualifiers
FT   CDS_pept        join(918517..918592,918664..919802)
FT                   /locus_tag="ANIA_10211"
FT                   /old_locus_tag="AN10211.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008120"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008120"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008120"
FT                   /db_xref="GOA:C8VMM6"
FT                   /db_xref="InterPro:IPR012890"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMM6"
FT                   /protein_id="CBF84984.1"
FT                   /translation="MSSGFANRRKPRKIGGDDGNDDEEQDTGPIIKRPVSLKVKQKSKA
FT                   RVSFGPGETSMTEGDDGESEVIVPKKHGLGRRVVEKNAFQKSTTPSALSNQLPLRVGPE
FT                   QDRPSYNEEYLNELRNLTASTPKPTADSENQNEVDVAAKFGEVTKVTAPSLIPTEAEIR
FT                   EKKARRARLAKEQDSHSLTEQDYISLEENAGDDWELVDREYDRDTRLVRDDEDFAEGFD
FT                   EYVEDGRISLGRKAEREQNRKQREAMRELIEDAEALMDEEDSDLEEKAAYEAAQTRAAM
FT                   GYGNGPVDRPKTPPKMTSLPRLSTCLDRLRMNLAVLEKSRTQMINRMEELRKEKANISV
FT                   REVEIQALIKETGDHYEKLKQEAGVTPGSEAETPGTTDFESSRGLENIGAPSTAVSKTN
FT                   SESET"
     atgagctctg gctttgctaa tcggaggaaa ccccgcaaga ttggcgggga cgacggcaat        60
     gatgatgagg agcaagacac tggcccaatc atcaagaggc cagttagttt gaaagtgaag       120
     caaaaatcca aagcgcgcgt ttcgttcggc cctggtgaaa cttcaatgac ggagggagac       180
     gacggcgaaa gcgaagtcat cgttccaaag aaacatggct tgggcagacg agtagttgag       240
     aagaacgctt tccagaaatc gacaactccg tccgcactaa gcaatcaact tccacttaga       300
     gttgggcccg aacaagaccg accaagttac aacgaggagt acttaaatga acttcgaaac       360
     ctgacggctt caacacccaa gcctacggcc gattctgaaa accagaatga agtggatgta       420
     gcggccaagt tcggtgaagt cacgaaagtc actgctccgt cgctgattcc cacggaggcc       480
     gagatcagag aaaagaaagc tcgacgcgcg aggttagcaa aggagcagga cagtcatagt       540
     ctaactgaac aggattatat atcgctggag gaaaatgcgg gcgatgactg ggaattggtc       600
     gacagagaat atgacaggga taccaggctc gtgcgagacg atgaagactt cgcggaaggg       660
     tttgacgaat acgtcgaaga tgggcgcata tctctaggga ggaaagctga acgtgaacag       720
     aataggaagc aacgtgaagc aatgcgcgag ctcattgaag atgcggaagc tcttatggac       780
     gaggaagact cggatctaga ggagaaggca gcctatgaag ccgctcagac aagagctgcg       840
     atgggatacg gcaatggtcc cgtagatcgg ccgaaaacgc cccctaagat gacatctctt       900
     ccccgtctct cgacatgcct cgacagattg cggatgaatc ttgcggtttt ggagaagtct       960
     agaacacaaa tgataaaccg gatggaggaa ctgagaaagg agaaagccaa tatatctgtc      1020
     agagaagtcg aaatacaggc tttgatcaag gaaactggtg atcattatga gaaacttaag      1080
     caagaagccg gtgtcactcc gggttccgag gctgagacgc cagggacaac agattttgag      1140
     agctcgcgcg gattagagaa tatcggagct ccatccacgg ctgtatccaa gactaactcg      1200
     gaaagtgaga cttga                                                       1215
//

If you have problems or comments...

PBIL Back to PBIL home page