(data stored in ACNUC16935 zone)

EMBL: BN001307.PE336

BN001307.PE336       Location/Qualifiers
FT   CDS_pept        join(920012..920088,920159..920319,920370..920722,
FT                   920780..921058,921123..921876,922684..922835)
FT                   /locus_tag="ANIA_10209"
FT                   /old_locus_tag="AN10209.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008121"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008121"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008121"
FT                   /db_xref="GOA:C8VMM7"
FT                   /db_xref="InterPro:IPR010640"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMM7"
FT                   /protein_id="CBF84986.1"
FT                   /translation="MSRTPFFSLGRWSLPRAERASIGPTQGLALIETPIDEKDGVPPHL
FT                   YRRSDATPIELFFDLFLVANLSTFTATHEINNVEALVTYIGFLGVIWFTWLQVMMFDIR
FT                   FARDSLFERICKAMQLGIMVGFASAGTRITTRVRPENVWAFQSLSLMLGGSRLLLSVQY
FT                   IVSTVLIRKRMSCASKGLYFIAAALLVSSLVHFGMYFVFGEDSAHSYVWTVWFVLFWVE
FT                   MWTVFATSCITPDIGFQDTPLNVRMGLLTLIIIGEGVISVTRLVNKTVRPGGWTRWSFV
FT                   HILGVTTNVYFIWQEYFDLTPTRTIGTFAQQIWAQLHFPFHVALVLLLEGSQILALTLD
FT                   ITLKLQYLTETILFACEEPRPDPELAVKLLCDTIADMEIEYSRGAISEQMAIHDILNDL
FT                   PNHEICPVNGTIGFTLTRNMFNDLVGNVTSALFSSMRIVPPQSAHVSTMDSSQLLRMYV
FT                   ELLGFVYVYYFLVASLAMLLFAAFGLLAQRHDKPLAMAIGVAVRIVSGIFLASLTIFAK
FT                   HFELAYSFMKSPTILYAFTFVLLGGTTEQNGSDGRLHAQRCATGLGLEAAKDTELELDR
FT                   AHALSALTWHAYRQL"
     atgagccgaa cgcccttttt ctccctaggt cgttggtcac tgccgcgggc tgagcgtgcg        60
     agtattggac ctacgcaagg gttagctcta atcgagacgc cgattgacga aaaagatggt       120
     gtccctccgc acctgtaccg ccgttcggat gcaactccaa ttgaattgtt tttcgatctt       180
     ttcctcgttg caaacctttc tacttttaca gccacgcatg agatcaacaa tgtagaagct       240
     ttggtgacct acattggatt tctgggtgtt atctggttca cctggctcca agtcatgatg       300
     ttcgatatcc gttttgctcg agactctctt ttcgaacgaa tctgcaaagc tatgcaacta       360
     gggatcatgg ttggcttcgc ttctgcaggg acaagaatta ccacgcgtgt ccgacccgag       420
     aacgtttggg cctttcagtc cctgagtctt atgctgggtg ggagcagact attactgtcg       480
     gtacagtaca ttgttagtac tgtcttgatt cgcaagcgaa tgagctgtgc ctcaaaaggg       540
     ctttatttca tagcagccgc tttactcgtt tcgagcttgg tacatttcgg aatgtatttt       600
     gtcttcggcg aagactcagc tcattcctac gtctggactg tttggtttgt actgttttgg       660
     gtcgaaatgt ggacggtttt cgcaacctcc tgcattactc cggacattgg gtttcaagac       720
     actcctctga acgtccgtat gggccttctt accttgatta tcattggtga aggggtcatt       780
     tctgttacaa gactcgtcaa taaaacggtg cggcctggcg gttggaccag atggtcgttt       840
     gtccatatct taggcgtcac gaccaacgtt tatttcatct ggcaggaata tttcgacctc       900
     actccaacgc gcacaatagg tacatttgcg caacaaattt gggcccaact tcattttcca       960
     ttccacgtgg ccctcgtcct tctactggag ggatcacaga tcctcgcatt gactctggat      1020
     attacattga agctgcagta cctgacagaa acgatcttgt ttgcatgcga agaaccgcga      1080
     ccggatcccg aattagctgt caaactgctc tgtgatacaa tagccgatat ggaaattgaa      1140
     tacagccgtg gagctatcag cgaacagatg gctattcatg acatcttgaa tgatcttcct      1200
     aatcacgaaa tctgccccgt caacggaaca atcgggttca cactcactag gaacatgttc      1260
     aatgatctgg taggaaatgt gacttcagct ctcttctcta gcatgagaat cgtgccgcca      1320
     cagagtgcgc acgtcagtac aatggatagc tctcagttac tgagaatgta tgttgagctt      1380
     ttgggtttcg tctatgtgta ctattttctt gttgcgtcac ttgcaatgtt actatttgct      1440
     gcctttgggc tccttgctca acgccatgac aaaccgctgg caatggcaat cggggtggcg      1500
     gttcgcatcg tctctggcat cttcctggca agccttacta tctttgcaaa acattttgag      1560
     cttgcgtatt cgttcatgaa gtcgccgact atactatacg catttacgtt tgttttattg      1620
     ggagggacga cagagcagaa cggttcggac gggagactac acgcacaacg ctgtgctact      1680
     gggctcgggt tggaagcagc aaaagacact gagctggagt tggaccgcgc acatgcactt      1740
     agtgcactga cctggcacgc ataccgacag ctgtga                                1776
//

If you have problems or comments...

PBIL Back to PBIL home page