(data stored in ACNUC16935 zone)

EMBL: BN001307.PE337

BN001307.PE337       Location/Qualifiers
FT   CDS_pept        join(925032..926315,926366..926522,926656..926675)
FT                   /locus_tag="ANIA_01497"
FT                   /old_locus_tag="AN1497.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008122"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008122"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008122"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD83"
FT                   /protein_id="CBF84987.1"
FT                   /translation="MTERNLLSSSCLAALPDSCAAAPAMSFDTSSTIGQRSESTMRCEQ
FT                   LQIGDHGETDGQYLATSAGVLNDDFSGRDFQTSGEQYRRWHANFSSTEPAKSVRPTSQN
FT                   SFHWKLQKIDRPSTKDTFTVEELNSNSGGAPTPDLVHPIPRHSPYAVTSYFTSEKIPET
FT                   STFGKTESPLSEDKKCLVRGSNWTSDDFAFSCLLQERQSPDASSLTTLPDNYTPVTTDG
FT                   TYTDHSVSPWPSVKTQLSWDTQTANATHCKEEVAWNEPRFFPDVEQQQTHFDQFPVTTD
FT                   NIHGFPSLGHSAETYVQPSSLLDPYGSTCPGLYLNGSTITQQEQSPIPYSSSTLVFQNG
FT                   LRPDESTDSFFPSGSISYQPSHVGHMATWTNDVKNALLIEYKRQGLSYKDIKRIAGFKE
FT                   AESTLRGRFRTLTKSKEQRVRKPQWHEKDVRLLCEAVNVYSEDGRISPYSRRPVPPTKI
FT                   PWKKVAQYIWNNGGSYHFGNSTYNMNSQ"
     atgactgagc gcaatcttct ctcttcttcc tgtttagccg ccctgcctga tagctgtgcc        60
     gccgccccag ccatgtcttt tgatacatca tcaaccatcg gtcaacgctc agaatccacc       120
     atgaggtgcg agcagcttca aataggtgac cacggagaga cagacggaca gtatttggcc       180
     acgtccgctg gtgtactaaa cgacgacttt tcaggacgag atttccagac cagcggagaa       240
     caatatcgac gttggcatgc caacttctca tcaaccgagc cggcgaaaag cgtccgacct       300
     acatcacaga actctttcca ctggaagctc caaaagattg accgacccag caccaaagat       360
     acgttcacag tcgaagagct taactccaat agtggcggtg cccctactcc agacttagtc       420
     caccctattc cgagacatag cccgtacgct gtgaccagct actttacctc cgagaagata       480
     ccagagacat caaccttcgg aaaaacggag agcccgctgt ctgaagacaa gaagtgtctg       540
     gtacgaggat caaattggac aagtgacgac tttgccttct catgtctgct tcaagaaaga       600
     caatcaccag acgccagctc gttgacgacc ctgcccgata attatacacc agtaaccact       660
     gacggcacat atactgatca ttcagtatcg ccttggccct cagtcaagac ccaactgtct       720
     tgggacacac agacggccaa tgccactcac tgcaaagaag aagttgcgtg gaatgaaccg       780
     cgatttttcc ccgatgtcga gcaacaacaa actcatttcg accaattccc tgtgacgacc       840
     gataacatcc atggctttcc gagcctaggc cacagtgccg aaacttatgt ccaaccctcg       900
     tcactgctgg acccttacgg atcaacttgt cctggcttgt acttgaacgg cagcacaatc       960
     acacaacaag agcaaagtcc tataccttac tcgagcagca ccttggtatt ccagaacggc      1020
     cttcgaccag acgagtcgac agactcattc tttccctctg ggtctatttc ctaccaacca      1080
     agtcatgttg gccacatggc tacttggact aacgatgtca aaaacgccct ccttatagaa      1140
     tacaagcgcc agggactgtc atacaaggac atcaaaagaa ttgctggttt taaggaggcc      1200
     gagtcaactc ttcgtggcag gtttcggact ttaacaaaat caaaagagca gcgcgttcgt      1260
     aaacctcaat ggcatgaaaa ggatgtgaga cttttgtgcg aagctgtcaa tgtatactcc      1320
     gaagacggta gaatcagccc ttattcaagg cgcccagttc caccaaccaa aataccctgg      1380
     aagaaagtcg ctcagtatat ctggaataac ggaggctctt accatttcgg taattccaca      1440
     tataatatga actctcaatg a                                                1461
//

If you have problems or comments...

PBIL Back to PBIL home page